KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324654
Entry
4324654           CDS       T01015                                 
Name
(RefSeq) probable starch synthase 4, chloroplastic/amyloplastic isoform X1
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324654
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4324654
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4324654
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4324654
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 4324654
NCBI-ProteinID: XP_015648269
UniProt: Q5JMA1
LinkDB
Position
1:complement(30032427..30041471)
AA seq 975 aa
MAACGAAAAEYSALLSLSCGPITRRRFAVSCRARPPGNLSAQQKKKRGKNIAPKQRSSNA
KLLLTTEENGQLPSTSLRTSMERPQKSTSSEDDTNGAISQIDEKIAAIGNEQQERSKDKH
FESDFQLEDFGEMIQNMEKNILLLNQARLQAIEDVDKILTEKEALQKKVDTLEMNLSKAL
ATKGNINTDIPGDHLEKFTKEILIESALSGGNPAHLCESPLFMELTVLKEENMLLKADAQ
FLKAKIVEFAETEEFLFKLEKERSLLDATVRELEARFLVAQTDIWKVVPLQYDVWMEKVE
NLQHMLGCLKNHVEKYAALLDQHDDLHDKIDELEASLKEGKTSEFSPYVVELLQQKLKAA
KSHHQAGHQETNTHIQVYQQLTEEFQDNLGKLIEESGRLEHSANSMPSEFWSHILLMIDG
WFLERKIPNTDARMLREMAWKRDDRICEAYFACKGAKESDVMETFLKLSLSGNSQCSSGL
HIVHIAAEMAPVAKVGGLADVVAGLGKALQTKGHLVEIVLPKYDCMQLDQITNLKVLDVV
IQSYFDGNLFSNNVWTGTVEGLPVYFIEPQHPSKFFWRAQYYGEHDDFKRYSYFSRAALE
LLYQSGKKIDIIHCHDWQTAFVAPLYWDIYATRGFSSARICFTCHNFEYQGTAPAPDLSY
CGLDVEQLDRPDRMQDNAHGRINVAKGGIVYSNIVTTVSPTYALEVRSEGGRGLQDTLKM
HSRKFVGILNGIDTGTWNPSTDRFLAVQYSATDLQGKAANKAFLRKQLGLYSEDASQPLV
ACITRLVPQKGLHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGVADQFQKNNNIRLI
LKYDEALSHCIYAASDMFIIPSMFEPCGLTQMIAMRYGSVPIVRQTGGLCDSVFDFDDET
IPVELRNGFTFARTDEQDLSSCLERAFSYYSRKPMVWKQLVQKDMQIDFSWDSPASQYEN
LYQSAVAQARGAAQT
NT seq 2928 nt   +upstreamnt  +downstreamnt
atggcggcttgcggcgccgcggcggcggagtattcagctctcctgtccctctcatgtggg
cctatcactcgccgccgtttcgccgtctcctgccgcgctcgaccgcccggcaacctcagt
gcacagcagaagaagaagcgagggaaaaacattgctccaaaacagcgctcttcaaatgca
aaactcttgcttactactgaggaaaatggacagcttccaagtaccagtttgaggacttct
atggaacgtcctcagaagagtacatccagtgaggacgataccaatggggctattagccag
atagatgaaaaaattgcagccattggtaatgaacagcaagagaggtcaaaggataaacat
ttcgaatcagactttcaacttgaagattttggggaaatgatacaaaacatggaaaagaat
attctgctcctaaatcaagctcgtcttcaagcaattgaagatgttgacaaaattcttact
gaaaaggaagctttgcagaaaaaggttgacactctagagatgaatttgtcaaaagcactt
gcaaccaaagggaacataaatacagatatccctggtgatcatttagagaaatttacaaaa
gaaattttgatagaaagtgctctaagtggaggcaatccagcacatttgtgtgagtctcca
cttttcatggagctgactgttctaaaagaagagaatatgctacttaaggctgacgcacaa
tttcttaaagcaaagattgttgagtttgctgaaacagaggaattcctattcaaattggag
aaagaaaggtcactgttagacgctacagttagggagctggaagctaggtttctagttgct
caaactgatatctggaaagttgtccctctgcaatatgatgtttggatggagaaagtagaa
aatctgcaacacatgcttggatgtttgaaaaatcatgtagagaagtatgctgcattgttg
gatcagcatgatgatctgcatgacaagattgatgagctagaagcatcactaaaagaaggg
aaaacatctgagttttctccttatgttgttgaacttctgcaacagaagttgaaagcagca
aaaagccatcaccaagcaggccatcaagaaacaaacactcacattcaagtatatcagcag
ttaactgaggaatttcaagataacctaggtaaactaatagaagaaagtggcagactggag
cattctgcaaatagtatgccatcagaattctggagtcacatcctgctcatgattgatggt
tggttccttgagcggaaaataccaaatactgatgcacgtatgctgagagaaatggcatgg
aagagagatgaccgtatctgtgaagcctactttgcttgcaagggtgcaaaagaaagtgat
gttatggaaactttcctaaagctatcgttatcaggaaacagtcaatgcagttctggcttg
cacattgtccatatagcagcagagatggctccagtggcaaaggttggcggtctggcagat
gtagttgctggtcttggcaaggcacttcagactaagggacatttagtagagattgttctt
cccaaatacgactgtatgcaacttgaccagattactaatcttaaggttttagatgttgtc
atacaatcctattttgatggaaatctattcagcaacaacgtgtggacaggaactgttgaa
ggtcttccagtctattttattgagccacagcatccttcaaaattcttctggagggcccaa
tactatggagagcatgacgattttaaacgttattcatactttagccgtgcagcactggaa
ttactttaccaatctgggaagaaaattgatataatccactgccatgactggcaaactgca
tttgttgcacctctatattgggatatatatgcaactcgaggcttcagctcagctagaatt
tgtttcacttgccacaacttcgaataccaaggtacagcacctgctcctgatttatcatat
tgcggccttgatgttgagcagttggatagaccagacaggatgcaagacaatgcacatgga
agaataaatgttgccaagggtggaattgtttattccaatattgtgacaactgtatcacca
acatatgctttagaagtgcgctcagagggtggtcgtggtctccaagatacacttaaaatg
cattccaggaaatttgtggggatacttaatggaatcgacacaggaacatggaacccttcc
acagacagatttcttgctgtgcaatatagtgctactgatcttcaggggaaagcagcaaac
aaagcatttctcaggaagcagctagggctgtattctgaggatgcctctcaaccactggta
gcctgcattacgaggctagttcctcaaaagggtctacatcttatcaggcatgcaatatac
aaaacagctgagttaggaggacagtttgtactcctgggttcaagtccagttccacatatt
cagagggaatttgagggtgttgcagaccaattccagaagaataacaatattaggttaatt
ctgaaatatgatgaagctttgtctcattgtatttatgcggcatctgacatgtttatcatt
ccatcaatgtttgagccttgtggccttactcagatgatagctatgagatatggttctgtg
ccaattgttcgacaaactggtggattgtgtgatagtgtttttgattttgatgatgaaact
atacctgtggagctgcggaatggctttacatttgctaggactgatgagcaggatctaagc
agttgcttggaaagggcattcagctactacagcagaaaacctatggtttggaaacagtta
gtgcagaaggatatgcagattgatttcagctgggattctccagcttcacagtacgaaaac
ctttatcagagtgctgttgctcaggcaaggggagcggctcaaacataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330709
Entry
4330709           CDS       T01015                                 
Name
(RefSeq) soluble starch synthase 2-2, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330709
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4330709
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4330709
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4330709
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 HflK_N
Other DBs
NCBI-GeneID: 4330709
NCBI-ProteinID: XP_015627452
UniProt: Q6Z2T8 D0TZP8
LinkDB
Position
2:complement(31233268..31238222)
AA seq 694 aa
MSGAIASSPAATLFLAGSSSSSPRRRRSRVSGVWWHLYGGTGLRLHWERRGLVRDGAVVC
SASAAGGEDGVAKAKTKSAGSSKAVAVQGSTAKADHVEDSVSSPKYVKPAVAKQNGEVVS
RATKSDAPVSKPKVDPSVPASKAEADGNAQAVESKAALDKKEDVGVAEPLEAKADAGGDA
GAVSSADDSENKESGPLAGPNVMNVIVVASECSPFCKTGGLGDVVGALPKALARRGHRVM
VVIPRYGEYAEAKDLGVRKRYRVAGQDSEVSYFHAFIDGVDFVFLEAPPFRHRHNDIYGG
ERFDVLKRMILFCKAAVEVPWFAPCGGSIYGDGNLVFIANDWHTALLPVYLKAYYRDNGL
MQYTRSVLVIHNIAHQGRGPVDDFATMDLPEHYIDHFRLYDPVGGEHSNVFAAGLKMADR
AVTVSHGYLWEIKTMDGGWGLHEIINHNDWKLQGIVNGIDMAEWNPEVDEHLQSDGYANY
TFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDVQV
VMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLNQL
YAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNYKE
SWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtcgggggcaatcgcttcctcgccggcggctactctcttcctcgctggctcctcctcc
tcttcgccgcggcgcaggcggagcagggtgagcggggtttggtggcacttgtatggtggc
acggggctgcggttgcattgggagcggcggggtttggttcgggacggagccgtcgtgtgc
tcggcgtcggccgccggtggtgaggatggcgtcgcgaaggcgaagacgaagtcagcgggg
agctcgaaggcggtcgctgtgcagggcagcacggccaaggctgatcatgttgaggattca
gtttcatcacccaaatacgtgaaacctgccgttgcgaagcaaaatggagaggttgtgagc
agagctaccaaatctgatgcaccagtgtctaaacccaaagttgacccgtcagttcctgct
tccaaggctgaagctgatggtaatgcacaagctgtggaatcgaaggctgcactggacaag
aaggaagacgtcggtgttgctgaaccgttggaagctaaggctgatgctggtggagatgca
ggtgcagtaagctctgcagatgatagtgagaacaaggaatctggtccattggcagggcca
aatgtgatgaatgtcattgtggtggcttctgaatgttctcctttctgtaaaacaggtggt
cttggagatgttgtgggtgctttgcctaaggctctggcaagaagaggacatcgtgttatg
gttgtgataccaagatacggagaatatgcagaagccaaggatctaggtgtccgcaaacgt
tacagggtagctggacaggattcagaagtgagttattttcatgcttttatcgatggtgtt
gattttgtgtttctagaggcccctccctttcgacaccggcacaatgatatttatggagga
gaaagatttgatgttttgaagcgtatgattttgttctgcaaagctgctgttgaggttcct
tggtttgctccatgtggtggttccatctacggtgatggcaatttagtcttcattgcaaat
gattggcatactgcacttttacccgtatatttgaaggcatattaccgagataatggcttg
atgcagtatactcgctctgttcttgtgatacacaacattgctcatcagggtcgtggccct
gtagatgacttcgccacgatggacttgcccgagcactacatcgatcatttcagactgtac
gaccccgtcggcggtgagcacagcaacgtgttcgccgctggcctgaagatggctgaccgc
gcggtcaccgtcagccatggctatctgtgggagatcaagacaatggacggtggctggggc
ctccacgagataataaaccacaacgactggaagctgcagggcatcgtgaacggcatcgac
atggccgaatggaaccccgaggtggacgagcacctgcagtccgacggctacgccaactac
acgttcgagacgctggacaccggcaagaaacagtgcaaggaggcgctgcagcggcagctg
ggcctgcaggtccgcgacgacgtgccgctgatcgggttcatcgggcggctcgaccaccag
aagggcgtggacatcatcggcgacgcgatgccgtggatcgccgggcaggacgtgcaggtg
gtgatgctgggcacggggcggccggacctggaggagatgctgcggcggttcgagtcggag
cacaacgacaaggtgcgcgggtgggtggggttctcggtgcagctggcgcaccggatcacg
gcgggcgccgacgtcctcctgatgccgtcgcggttcgagccgtgcgggctgaaccagctg
tacgccatggcgtacggcaccgtgcccgtggtgcacgccgtgggcgggctccgcgacacg
gtggcgccgttcgacccgttcgccgacacggggctcgggtggacgttcgaccgcgccgag
gcgaaccggatgatcgacgcgctcgggcactgcctcaacacgtaccggaactacaaggag
agctggagggggctccaggcgcgcggcatggcgcaggacctcagctgggaccacgccgcc
gagctctacgaggacgtcctcgtcaaggccaagtaccagtggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337056
Entry
4337056           CDS       T01015                                 
Name
(RefSeq) starch synthase 3, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4337056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4337056
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4337056
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4337056
SSDB
Motif
Pfam: CBM53 Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 FmiP_Thoc5
Other DBs
NCBI-GeneID: 4337056
NCBI-ProteinID: XP_015636215
UniProt: A0A8J8YHC2 Q0J9Z0
LinkDB
Position
4:complement(31751598..31759576)
AA seq 1216 aa
MEMAHSPLCSRSRPVLVVRPATAATGFAQPIIRCRRFTRTRLLRCLVASADYSKRNPRRA
STPKPKGAASRTYAPRPTVESSMKKIGQSGTDEGDLGTSNGKLSSEATEQTSNVEESSEV
DFSGNVSSSVFLEGMDDAFEAETEEEVEQNQSPELSSESMDDDAIDRKLDEYRGKISALI
SSKPEPTSVSSTHVQDRSIVGFHEQEKSVVSFHEQDRSIVSVPEQSQPSSGVSGQNPTEE
KTIISGQDVTEEAPEEITGKSIEREPLSRETEKVLFADDDPRIIKDEQYEPDIAPVQDDV
DPQVLRRRLEELAEKNYLAGNKCFVFPEVVQADSVIDLYLNHSMSALASEPDILIKGAFN
GWRWKKFTQKMHKSELTGDWWCCKLHIPKQAYRLDFVFFNGDTIYENNNHNDFVLQIESE
INEHSFEDFLVEEKQRELERLAAEEAERKRQAEEERRKEEERAAMEADRAQAKAEVEMNK
NKLQNLLNSASRYADNLWYIEPHTYKAGDRVKLFYNRSSRPLMHNTEIWMHGGYNNWSDG
LSIAEKLIKSYEKDGDWWYADVTLPEGALVLDWVFADGPPGNARNYDNNGRQDFHAVVPN
NISEDLFWVEEEHMIFKRLQKERKEREDADRRKSEITAKMKAEMKEKTMRDFLLSQKHIV
YTEPLEVRAGTTVDVLYNPSNTVLNGKPEVWFRCSFNRWTHPSGPLPPQKMVNAENGSHL
RATVRVPLDAYMMDFVFSESEEGGIYDNRNGMDYHSPVTDSVAKEPPMHIVHIAVEMAPI
AKVGGLGDVVTSLSRAVQDLGHNVEVILPKYDCLNLSNVKDLHYRQSFTWGNTEIKVWFG
KVEDVPVYFLEPQNGMFWVGCVYGRNDESRFGFFCHSALEFLRQNGSSPDIIHCHDWSSA
PVAWLFKEQYAQNGLSNGRVVFTIHNLEFGAHHIGKAMARCDKATTVSYTYSREVSGHGA
IAPHFSKFHGIRNGIDPDIWDPYSDNFIPVHYTSENVVEGKSAAKKALQQRLGLQQTDTP
VVGIISRLTVQKGIHLIKHAIYRTLERNGQVVLLGSAPDHRIQGDFTNLASKLHGEYHGR
VKLCLTYDEPLSHLIYAGADFILVPSMFEPCGLTQLTAMRYGSIPIVRKTGGLYDTVFDV
DDDKDRAREQGLEPNGFSFEGADSNGVDYALDRAITTWYDARDWFHSLCKRVMEQDWTWN
RPALDYMELYHSARKN
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggagatggcgcatagcccgctctgctcccggagccggccggtgctcgtcgtccgcccg
gcgacggccgccactggcttcgcgcagccgatcataaggtgcaggagatttacaaggaca
aggcttctccgatgcttggtggcaagtgcagattattctaagagaaacccaaggagagcc
tccactccgaaacctaaaggtgctgcctctagaacatatgctccgagacctactgttgaa
tccagcatgaagaagattggacaaagcggcacagatgaaggtgatcttggcacaagcaat
gggaagctcagtagtgaagcaacagagcaaactagtaatgtagaagaatcatcggaggtg
gacttctctggaaatgtatcgagcagtgtattcttggagggaatggatgatgcttttgaa
gctgagactgaagaagaggtcgagcaaaatcagtctccagaactgtcttctgaatctatg
gatgatgatgcaattgacagaaaacttgatgaataccgtggtaaaataagtgcactaata
agttcgaaacctgaacctacatcagtttctagcactcatgtacaggacagatcaattgtt
ggttttcatgaacaagaaaaatctgtagttagtttccatgagcaagatagatcaattgtc
tctgttcccgaacaaagccagccaagtagtggtgtcagtggacaaaatccaacagaagag
aaaaccattattagtggacaagatgtcaccgaagaagcaccagaagagataactggcaag
agtattgagagggaaccattaagtagagaaactgagaaagttctgtttgctgatgatgac
cctaggataatcaaggatgaacagtatgaacctgatatagcaccagtacaggatgatgtg
gatccacaagtgctcaggaggcggcttgaagagcttgctgagaaaaattatttggctggg
aataagtgttttgtttttcctgaagtagtacaggcggattcggtcattgatctttacttg
aaccatagcatgtcagccttagccagtgagcctgatattcttatcaaaggggcattcaat
ggttggagatggaaaaaatttacccaaaaaatgcataaaagtgagttaacaggggattgg
tggtgctgcaaactccatatacccaagcaggcttacagattagattttgtattctttaat
ggtgacaccatctacgaaaataacaatcataatgatttcgtcctacaaatagaaagcgaa
atcaatgaacactcatttgaggacttcttggttgaagaaaaacaaagagagcttgaaagg
cttgctgcagaagaagctgaaaggaaaagacaggctgaggaggagcgtcgtaaggaggaa
gaaagggctgcaatggaggctgacagggcacaagcaaaggctgaagtcgagatgaacaag
aataagttgcaaaatttattaaattcagccagcagatatgctgataatctatggtatata
gagcctcacacatacaaagcaggggatagggtcaaattgttctacaacagaagctcaaga
ccgctaatgcataacactgagatttggatgcatggcggttacaataattggagtgatggg
ctctctattgctgaaaaattaatcaaatcatatgaaaaggatggtgattggtggtatgca
gatgttactctacctgaaggggcattggtgttagactgggtttttgctgatgggccacct
gggaatgcaaggaattatgataacaatggacgccaggatttccatgctgttgttccaaat
aacatatctgaggacctgttttgggtggaagaagagcacatgatatttaaaaggcttcag
aaagaaaggaaagaaagggaggatgctgatcgaagaaagtctgagataactgcaaaaatg
aaagctgagatgaaggaaaagactatgagagactttcttctctcgcagaaacacattgtg
tacactgagcctctcgaagtacgtgcaggaaccaccgtggatgttctatacaatccgtct
aacacggtgctgaacggaaagccagaggtttggttcagatgttcctttaatcgttggact
catccaagtggtcctttgccgccacagaagatggtgaatgcggagaatggttcacactta
agagcaacagttagggttcctttggatgcatatatgatggactttgttttctctgagtcg
gaagaaggtggaatatatgacaacaggaatggcatggactatcatagtcctgtgactgat
tccgttgcaaaagaacctcctatgcatattgtgcacattgcagtagaaatggctcctatt
gcaaaggttgggggtcttggtgatgttgttacaagtctttcacgagccgttcaagattta
ggccacaatgttgaggttattcttcccaagtatgactgtttaaacctaagcaatgtgaaa
gatttacattaccgtcaaagttttacttggggtaatacagagataaaagtatggtttgga
aaagttgaagacgtccctgtttacttcttggaaccacagaatgggatgttttgggttgga
tgtgtctatggaagaaatgacgagagtagatttggcttcttctgccattctgctctagag
tttctccgccaaaatggatcttctcctgatattatacattgtcatgattggtcaagtgct
ccagttgcttggctattcaaggaacaatatgctcaaaatggactgtcaaatgggcgggtt
gtatttaccatccacaaccttgaatttggtgcacatcacatcggcaaagcaatggcacgt
tgtgataaggctacaactgtttcatatacgtattcaagggaagtgtcaggacatggtgct
attgcccctcacttttccaaattccacggtattcgtaacggaattgatccagatatttgg
gatccatacagtgacaattttatcccggtccactatacctctgagaatgttgttgagggc
aagagtgctgccaaaaaggcattgcaacagaggcttggactacagcaaactgatacccct
gttgttggaattatcagtcgtctgacagtccagaagggaattcaccttatcaaacatgca
atttatcgaactcttgaacgcaatgggcaggtggttttactaggctcagctccagatcat
cgcatacaaggtgactttaccaacttagctagtaaactgcatggcgaataccatggtcgt
gtaaagctttgtttaacctatgatgagccactatctcatttgatttatgctggtgccgac
ttcatccttgttccttccatgtttgaaccttgtggtttaacccagcttactgctatgcgt
tatggatctatcccaatagttcggaaaactggaggcctttatgacaccgtttttgacgtc
gacgatgataaggatcgagctcgagaacaaggtcttgagccaaacgggttcagtttcgaa
ggagctgacagcaacggtgtggattacgcccttgacagagcgatcaccacatggtatgat
gctcgcgattggttccactccctctgcaagagggtgatggagcaagattggacatggaac
cgacctgctctggactatatggaattgtaccattccgctcgcaagaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339426
Entry
4339426           CDS       T01015                                 
Name
(RefSeq) probable starch synthase 4, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4339426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4339426
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4339426
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4339426
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Med2 DUF1688 Citrus_P18 Mcm10 Birna_RdRp_C
Other DBs
NCBI-GeneID: 4339426
NCBI-ProteinID: XP_015639005
UniProt: Q84VC7 Q0DGG7
LinkDB
Position
5:26485773..26494167
AA seq 915 aa
MACLAAGAEAAPLLFRRRLAPSPVAARRRLLVSCRARRRGLRTAAELPRKSTSNDKHHNR
VNMQRDEASVSSDKERQEKYGDENGISNLQLEDLIQMIQNTEKNIMLLNQARLQALEHVE
TVLKEKEDLQRKLKILETRLSETDARLKLSAEGQFGTEINDSLPVLELDDIKEENMLLKD
DIQFLKTMLIEVAETENSIFTLEKERALLDASLRELESRFIDAQADMLKSDPRQYDAWWE
KVENLGDLLETATNKVENAAMVLGRNHDLEDKVDKLEASLAEANISKFSCYFVDLLQEKI
KSVEERFQVCNHEMHSQIELYENSIAEFHDILSKLVEETEKRSLEHSASSMPSELWSRIS
LLIDGWLLEKRISYNDANTLREMVRKRDSCLREAYLSCRGMKDREIVDNFLKITLPGTSS
GLHIIHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKYDCMQNDQVNNLKVLD
VVVQSYFEGNLFNNKIWTGTVEGLPVYFIEPQHPAKFFWRAQYYGEHDDFKRFAYFSRAA
LELLYQSQKKIDIIHCHDWQTAFVAPLYWEAYANLGFNSARICFTCHNFEYQGAAPAQDL
ACCGLDVQQLDREDRMRDNSHGRINVVKGAIVYSNIVTTVSPTYALEVRSEGGRGLQDSL
KLHSRKFVGILNGIDTDTWNPSTDRHLKVQYNANDLQGKAANKAALRKQLNLSSTNASQP
LVGCITRLVPQKGVHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGIADHFQNNNNIR
LLLKYDDSLSHWIYAASDMFIVPSMFEPCGLTQMIAMRYGSVPIVRKTGGLNDSVFDFDD
ETIPKELRNGFTFVHPDEKALSGAMERAFNYYNRKPEVWKQLVQKDMRIDFSWASSASQY
EDIYQRAVARARAAA
NT seq 2748 nt   +upstreamnt  +downstreamnt
atggcgtgcttggcggcgggcgccgaggcggcccctctcctcttccggcggcggctagcg
ccgtccccagtcgccgcgcgccgccgccttctcgtgtcgtgccgagctcgccgccgcggt
ctcaggactgctgcagaacttcctcggaagagtacaagtaatgataaacaccataatagg
gtgaatatgcagagagatgaagcatctgtttccagtgataaagaacggcaagagaaatat
ggagatgaaaatggtatatcaaaccttcaattggaagatttgatacaaatgatacaaaac
actgagaagaatataatgcttctgaatcaagctcgtcttcaagcattggaacatgttgaa
acagttcttaaagaaaaagaagacttacagaggaagttgaaaattttggagacgagattg
tcagaaacagatgcacggcttaagctttcagctgaagggcagttcggtactgagattaat
gactctctaccagtactggaattagatgatataaaggaagagaatatgctactgaaggat
gacatacaatttctgaaaacaatgcttattgaggttgctgagacagagaacagtatattc
acattagagaaggagcgtgctcttttagatgcttcgcttagggagctggagtctagattt
atagatgcccaagcagatatgttgaagtctgatcctaggcagtatgatgcatggtgggag
aaagtagaaaatttgggggacttgcttgagactgcaacaaacaaagtagagaatgctgct
atggttctgggacgcaatcatgatttggaagataaggtcgacaaactagaggcatcgttg
gctgaagcaaatatatcaaagttctcttgttattttgttgatcttttgcaggaaaagata
aaatcagtagaagagcgcttccaagtatgtaatcatgaaatgcattctcaaattgaactc
tatgagaattcaatagcggaatttcacgatattcttagcaagctagtggaggaaactgag
aaacgatcactagagcattcagcaagtagcatgccttcagaattgtggagtaggatatct
cttctgattgatggttggttgctcgagaagagaatatcctacaatgatgcaaatacatta
cgggaaatggtcaggaaaagggatagttgtcttcgggaagcatacttgtcatgcagaggt
atgaaagatagggaaattgtggacaattttctaaagatcacattgccagggactagttct
ggcttgcacatcatccacatagcagcagagatggctcctgttgcaaaggttggtggtttg
gcggatgtgatatctggtcttggcaaggcacttcagaaaaagggccacctagtagagatt
attcttccaaaatatgactgcatgcagaatgaccaagttaataaccttaaggttttagat
gttgttgtacaatcctactttgaaggaaatttgttcaacaacaaaatatggactgggact
gttgaaggccttccagtctattttatcgagccacaacatccagcaaaattcttttggagg
gcacaatactatggagaacacgatgactttaaacgttttgcatacttcagccgtgcagca
ctggaattactttaccaatcgcagaagaaaattgacatcatccattgccatgactggcag
actgcatttgtggcacctctttattgggaagcatatgcaaatctgggcttcaactcagct
agaatttgcttcacctgccataattttgaatatcaaggagctgctcctgctcaagattta
gcatgctgtggccttgatgttcagcaacttgatagggaagacaggatgcgggacaattca
catggcagaataaatgttgtcaagggtgcaattgtgtattccaacattgtgacaactgta
tcaccaacatatgcactagaggtgcgatcagagggtggacgtggactacaagattcactc
aaattacattccaggaaatttgttgggatacttaatggaatcgacacagacacatggaat
ccttcaacagatagacatctcaaggttcaatataatgctaatgatctccagggtaaggca
gcaaacaaagcagctctcagaaagcagctaaacttatcttctacaaatgcttctcaacca
ctggttgggtgtattacaaggctagttcctcaaaagggtgtacatctcatcaggcatgca
atatacaaaacagctgagctaggaggacagtttgttcttctgggctcaagtccagtacca
cacattcaaagagagtttgagggtattgcagaccattttcagaacaataacaatatccga
ctgcttttgaagtatgatgattctttatcccattggatttatgcagcatctgacatgttc
attgttccatccatgtttgagccatgtggcctcacacagatgattgccatgagatatggt
tctgtgccgattgttcggaaaaccggtggattgaatgacagtgtcttcgatttcgacgac
gaaacgatacctaaggagctgcggaatggctttacgtttgtgcatcctgatgaaaaggct
ctaagtggtgcaatggagagagcgttcaactactacaatagaaagcctgaggtctggaaa
cagctggtgcagaaggacatgaggatagatttcagctgggcctcttcagcttcccagtac
gaagatatctatcaaagagcagtggctcgagcgagggcagcagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340567
Entry
4340567           CDS       T01015                                 
Name
(RefSeq) soluble starch synthase 2-3, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4340567
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4340567
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4340567
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4340567
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 4340567
NCBI-ProteinID: XP_015644246
UniProt: Q0DDE3 B7ESH5
LinkDB
Position
6:6748306..6753338
AA seq 810 aa
MSSAVVASSTTFLVALASSASRGGPRRGRVVGVAAPPALLYDGRAGRLALRAPPPPRPRP
RRRDAGVVRRADDGENEAAVERAGEDDDEEEEFSSGAWQPPRSRRGGVGKVLKRRGTVPP
VGRYGSGGDAARVRGAAAPAPAPTQDAASSKNGALLSGRDDDTPASRNGSVVTGADKPAA
ATPPVTITKLPAPDSPVILPSVDKPQPEFVIPDATAPAPPPPGSNPRSSAPLPKPDNSEF
AEDKSAKVVESAPKPKATRSSPIPAVEEETWDFKKYFDLNEPDAAEDGDDDDDWADSDAS
DSEIDQDDDSGPLAGENVMNVIVVAAECSPWCKTGGLGDVAGALPKALARRGHRVMVVVP
RYGDYAEAQDVGIRKYYKAAGQDLEVKYFHAFIDGVDFVFIDAPLFRHRQDDIYGGNRQE
IMKRMILFCKAAVEVPWHVPCGGVPYGDGNLVFLANDWHTALLPVYLKAYYRDNGMMQYT
RSVLVIHNIAYQGRGPVDEFPYMELPEHYLDHFKLYDPVGGEHANIFGAGLKMADRVVTV
SPGYLWELKTTEGGWGLHDIIRENDWKMNGIVNGIDYREWNPEVDVHLQSDGYANYTVAS
LDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDVQLVLLG
SGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLNQLYAMA
YGTVPVVHAVGGLRDTMSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKYKESWRG
LQVRGMSQDLSWDHAAELYEEVLVKAKYQW
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgtcgtcggccgtcgtcgcgtcatccaccacgttcctcgtcgcgctcgcctcttcggcg
tcacggggagggcccaggagggggagggtggtgggcgtggccgcgccgccggccctgctt
tacgacggccgcgccggaaggctagccctacgggcgccgcctccgccccggcctcggcct
cggcgtcgggatgcgggcgtggtgcgccgcgcggatgatggggagaacgaggcggcggtg
gagcgggcgggtgaggacgacgacgaggaggaggagttctcttcgggcgcgtggcagccg
ccccgctcgcgtcgcggcggcgtcggcaaggtcttgaagcggaggggcaccgtcccgccc
gtcggccggtacggctccggcggtgatgcggcgagagtgcgcggggcggccgcgccggcg
ccggcgccgacacaggacgccgcctcaagtaagaacggagcgcttctcagcggccgcgac
gacgacacacctgcctcacggaacggatcggtcgttaccggcgccgacaagcctgccgcc
gccacgccgccggtgaccataacgaagctcccagcgccggactcccccgtgatccttcca
tccgtagacaagccgcagccggagttcgtcatcccagacgcgacggcgccggcgccgcca
ccgcccggttcaaatcccaggtcgtccgctcctctccccaagcctgacaattcggaattt
gcagaggataagagcgcaaaagttgttgagagtgctccgaagccaaaggcgactagatct
tcccctattcctgcggtagaagaggagacgtgggatttcaagaaatattttgatctgaac
gaaccggacgccgcggaggatggcgatgacgatgatgactgggctgattcagatgcgtca
gattctgagatcgaccaggatgacgattcgggccctttggctggggagaatgtcatgaac
gtgatcgtggtggctgctgaatgttctccctggtgcaaaacaggtgggcttggagatgtt
gcaggtgctttacccaaagctttggcgaggagaggacatcgtgttatggttgtggtacca
aggtacggtgattacgcggaagcccaggatgtaggaatcaggaaatactacaaggctgct
ggacaggatctggaagtgaaatatttccatgcatttatcgatggagttgattttgtgttc
attgacgctcctctcttccgtcaccgtcaggatgacatctatggggggaacagacaggaa
atcatgaagcgcatgattctgttttgtaaggctgctgttgaggttccttggcacgttcca
tgcggtggtgtgccctatggggatggcaacttggtgttccttgcaaacgattggcacact
gcactcctgcctgtttatctgaaggcatattacagagacaatggcatgatgcagtacact
cgctctgtccttgtgatacataatatcgcttaccagggccgtggcccagtagatgaattc
ccctacatggaattgccggagcactacctggatcacttcaagctgtacgaccccgtcggc
ggcgagcacgccaacatcttcggcgcgggcctgaagatggcggaccgggtggtgaccgtg
agccccggctacctctgggagctgaagacgacggagggcggctggggcctccacgacatc
atacgggagaacgactggaagatgaacggcatcgtgaacggcatcgactaccgggagtgg
aacccggaggtggacgtgcacctgcagtccgacggctacgccaactacaccgtggcctcg
ctggactccagcaagccgcggtgcaaggcggcgctgcagcgcgagctggggctggaggtg
cgcgacgacgtgccgctgatcgggttcatcgggcggctcgacgggcagaaaggtgtggac
atcatcggcgacgcgatgccgtggatcgccgggcaggacgtgcagctggtgctgctgggc
tccggccgccgcgacctggaggtgatgctgcagcggttcgaggcgcagcacaacagcaag
gtgcgcgggtgggtggggttctcggtgaagatggcgcaccggatcacggcgggcgccgac
gtgctggtcatgccgtcgcggttcgagccgtgcggcctcaaccagctctacgccatggcg
tacggcaccgtccccgtcgtgcacgccgtcggcgggctgagggacaccatgtcggcgttc
gacccgttcgaggacaccggcctcgggtggacgttcgaccgcgccgagccgcacaagctc
atcgaggcgctcggccactgcctcgagacgtaccgcaagtacaaggagagctggaggggg
ctccaggtgcgcggcatgtcgcaggacctcagctgggaccacgccgccgagctctacgag
gaggtccttgtcaaggccaagtaccaatggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348711
Entry
4348711           CDS       T01015                                 
Name
(RefSeq) soluble starch synthase 2-1, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4348711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4348711
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     4348711
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4348711
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 4348711
NCBI-ProteinID: XP_015614561
UniProt: Q7XE48 D0TZN5
LinkDB
Position
10:15673102..15681111
AA seq 749 aa
MAAAAVSSLLAPSGSCYSPGCHSCWGPGPGGGRRLPSPRRRPITAAARPTWAVPRRSRLE
WGRVEAQNSGARTSCRAALQWLSSTARSHVNVGYGSPLVFPGLTKPGSSRCLCVVGMVGN
AGNQVGDDSDDGIKVTNEKLRAVIRKSKEVLEIHRNLLEKISASERKKITSIIEDSSIYN
EQDPFGQRDSSFYHLDEVPDDDEFSYDLQMYLDRRPDQSEVVATQDYEAQLSQISEMGQS
VAEGTSDDPSASAAVDLINIILVAAECAPWSKTGGLGDVAGALPKALARRGHRVMVVVPM
YKNYAEPQQLGEPRRYQVAGQDMEVIYYHAYIDGVDFVFIDNPIFHHVENDIYGGDRTDI
LKRMVLLCKAAIEVPWYVPCGGYCYGDGNLVFLANDWHTALLPVYLKAYYHDNGFMIYAR
SVLVIHNIAHQGRGPLDDFSYLDLPVDYMDLFKLYDPFGGDHLNIFAAGIKAADRLLTVS
HGYAWELKTAEGGWGLHGIINESDWKFQGIVNGIDTTDWNPRCDIHLKSDGYTNYSLETV
QAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDVQLIMLGT
GRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLNQLYAMMY
GTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRLIDALGHCLNTYRNYRTSWEGL
QKRGMMQDLSWDNAAKLYEEVLLAAKYQW
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggcggcggcggccgtctcctccctcctcgccccttcgggatcctgctactcccccgga
tgccacagctgctggggtcccgggcccggaggcgggcggcgcctaccttccccgcgccgg
cgcccgattaccgccgcggctcgccctacttgggcagtgccgaggaggagcaggttggag
tgggggcgtgtggaggctcagaattcgggcgctcgcaccagctgccgagcagcactgcaa
tggctatcatccacggcaaggtcccatgtgaatgttggttatgggtcgccgctggtgttc
ccaggtttgaccaaaccggggtcaagcaggtgtctatgcgttgttggaatggtcggcaat
gcagggaatcaagttggtgacgatagtgatgatggaatcaaggttaccaatgagaagctt
cgtgctgttatccgcaagagcaaagaggtgttggagatccatcggaatctacttgagaag
atatcggcatcagaaaggaagaagatcacttcaattatagaggacagttccatttataat
gagcaagatccatttggtcaaagagatagttctttttatcatcttgatgaagttccagac
gatgatgaatttagctatgacctacagatgtaccttgatagacgtccagatcaatctgaa
gttgttgcaactcaggattatgaggcacaactaagtcaaataagtgaaatgggacagtca
gttgctgagggcactagtgatgatccatctgcttcagctgctgtagatcttatcaatatc
atattggtagcggcggagtgtgctccttggtccaaaacaggtgggcttggagatgttgct
ggagctttgccaaaggctttggctaggagaggtcaccgtgtcatggtagtagtgccaatg
tataaaaactacgcagaacctcaacagctaggagagccaaggagataccaggttgcaggg
caggatatggaggtaatttattatcatgcatacatagatggtgtggattttgttttcatt
gacaatcctatcttccaccacgttgagaatgacatttatggcggagaccgaacagacatc
ttaaaacggatggttttgttgtgcaaagcggctatagaggttccatggtatgttccttgt
ggtggctactgctacggtgatggaaatcttgtgttccttgcaaatgattggcatactgca
ctactgcctgtttatttgaaggcatactatcatgacaatggtttcatgatatatgcccgt
tctgttcttgtcatacacaatatagcacatcagggtcgtggcccattagatgacttcagt
tatctggatttgccagttgattacatggatcttttcaaactttatgacccatttgggggt
gatcacctaaacatatttgcagctggtattaaagctgctgaccgtttgcttactgtaagc
catggttatgcatgggagctcaaaacagctgaaggtggttggggtcttcatgggatcatc
aatgaaagcgattggaaatttcagggcattgtaaatggcattgatacaactgattggaat
cctaggtgtgatatccacctaaaatctgatgggtacaccaattattctctagaaacagtt
caggcaggtaaacagcaatgtaaggcagcattgcagaaggaacttggtctcccagttcgt
ggcgatgttcctgtcattgctttcattggacggctagaccatcaaaaaggtgtagacctt
atagcagaagcaatgccatggattgctggccaagatgtacagttaataatgttgggcact
ggacggcaagacctcgaagatacattgaggaggcttgagagccaacattacgatagagtt
agggggtgggttggtttttccatcaggttggctcatcgaatgacagcaggggctgatata
ctattgatgccatcaaggtttgagccatgtggattgaatcagctctatgccatgatgtat
gggactgtcccagtagtccatgcggtcggtggtcttcgagacaccgttgagcactacaat
ccctacgaggagtccggacttggttggacttttgaaaaggcagaggcaaacagactgatt
gatgctctagggcactgcttgaacacgtacaggaactacaggactagttgggagggactc
caaaagagagggatgatgcaagatctaagttgggataatgctgctaagctgtatgaggaa
gtcctcctagctgccaagtatcaatggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268758
Entry
9268758           CDS       T01015                                 
Name
(RefSeq) starch synthase 3, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    9268758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9268758
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     9268758
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   9268758
SSDB
Motif
Pfam: CBM53 Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_4_4 CBM_25
Other DBs
NCBI-GeneID: 9268758
NCBI-ProteinID: XP_015650668
UniProt: A0A0P0XCU3
LinkDB
Position
8:5349928..5363361
AA seq 1788 aa
MEMALRPQSLLCPRSRLKVVIRPASSASGGGLAQYFLMTRRYTGSRIVRCMVSSSDCPNR
KAKRTISLHTEVASSRGYAPRIAAESSIQEREHINSDEETFDTYNRLLRNESTEWKKLDT
TEVDLSQDVSSSSMRKVDATDEAKLDILEDDLPRNLLNGVTMGEVDMLDEAGAEDDVFEV
DLSALHNSTVGKMDAVNEVGTENDLFEVDLSALHSAAVGKVDVVDGAKAKEDLFEMDSLA
LHSVTMGKVDAINAAGAEGDKFEVDLSALASNNSMIEAVNVMDEAKAIEDTLEVDLSGNA
TSSSTYGEVKFEVDSLGNTSSTVMYGPADGAYEPRSDEVTFKVDSSENASNNVMYGRADV
VDESWADEGIFEVDFFTNASSGAEYGKVDVVDEAKTDDFTFEIDSLEKDSNNKMHGKAHM
VDEAWDDEAIFEVDLFGNASSIPIYGEVNVLDEARADDGKFEVDLLGNTSSNSTHEEVDV
VDEAQTGEATFEVDLLGNALSSAIYKEVPVMGGAQDDEVDVDFSINASITETEKEADAVD
EARVEDETFDMDLVGKQISIDSMNDDVVEEGTKHHRYPMLSSAFIEVKTIHETPVSLKPE
LMSVVMDQEQDKPISSVYQQEGSIFNLHAENQSTVDFHEREQMAITFDKQKESVAKLSKE
DQQTAGLPEQNMSFDGVHRKSQSIIGLPFQHQSIVSSPEKYRSIVGFHGQNQSIISSHKQ
DKSIVGVPKKIQSIVGSTKHDDSIVGFRKQDRSIVSVPEQKQSIVGFHKQDLSIVAVSEQ
NLSIVAIPRESQSKQISIVRRHDPLHLKEVETKDRDGISKKSGGDDDLPHMLFEEELSQV
EDVARAIAYKKQHEVDVISLTPDIQESPQDNIDPQELRRMLQELADQNCSMGNKLFVFPE
AVKANSTIDVYLNRNLSALANEPDVHIKGAFNSWRWRPFTERLHKSELSGDWWSCKLHIP
KEAYRLDFVFFNGRLVYDNNDSNDFVLQVESTMDEDSFEEFLVEEKKRELERVATEEAER
RRHAEEQQRMGEQRAAEQAAREQAKKEIELKKNKLQNLLSSARTHVDNLWHIEPSTYRQG
DTVRLYYNRNSRPLMHSTEIWMHGGCNSWTDGLSIVERLVECDDENGDWWYANVHIPEKA
FVLDWVFADGPPGNARNYDNNGRQDFHAILPNAMTNEEYWVEEENCIYTRLLHEIREREE
AIKIKVEKRAKMKSEMKEKTMRMFLLSQKHIVYTEPLEIRAGTTVDVLYNPSNTVLNGKP
EVWFRWSFNRWMHPSGVLPPKKMVKTEDGCHLKATVSVPSDAYMMDFVFSESEEGGIYDN
RNGTDYHIPVSGSNAKEPPIHIVHIAVEMAPIAKVGGLADVVTSLSRAIQELGHHVEVIL
PKYNFMNQSNVKNLHVRQSFSLGGTEIKVWFGLVEDLSVYFLEPQNGMFGGGWVYGGNDA
GRFGLFCQSALEFLLQSGSSPHIIHCHDWSSAPVAWLYKEHYAESRLATARIIFTIHNLE
FGAHFIGKAMTYCDKATTVSHTYSKEVAGHGAIAPHRGKFYGILNGIDPDIWDPYTDNFI
PMHYTSENVVEGKNAAKRALQQRFGLQQTDVPIVGIITRLTAQKGIHLIKHALHRTLERN
GQVVLLGSAPDPRIQSDFCRLADSLHGENHGRVRLCLTYDEPLSHLIYAGSDFILVPSIF
EPCGLTQLVAMRYGSIPIVRKTGGLYDTVFDVDHDKDRARVLGLEPNGFSFDGADCNGVD
YALNRAISSWFEARGWFHSLCKRVMEQDWSWNRPALDYIELYHSAHKF
NT seq 5367 nt   +upstreamnt  +downstreamnt
atggagatggctctccggcctcaaagccttctatgccctcggagcaggctgaaggtcgtc
atccggccagctagcagtgccagcggtggtggcctcgcgcagtatttcttaatgaccagg
agatatactggaagcagaattgttcgatgcatggtttcaagttcagactgtcctaatagg
aaagcaaagaggacgatttcccttcatacggaagtcgcttcttctaggggatatgctccg
agaattgctgctgaatcaagtattcaggagcgagaacatattaatagtgatgaagaaaca
tttgatacgtacaacagattactacgtaatgagtcaacagagtggaaaaagttagatact
actgaagtggatttgtcacaagatgtttcaagcagttcaatgaggaaagtggatgcgacg
gatgaagctaagctagatatacttgaggatgatttgcccagaaatttgttgaacggtgta
acaatgggggaagtagatatgttggatgaagctggggcagaagatgatgtatttgaggtg
gacttgtcagccttgcataattccacagtggggaaaatggatgcggtaaatgaagttggg
actgaaaatgacttatttgaggtggatctgtcagcattgcatagtgctgcagtggggaag
gtggatgtagtagatggagctaaagctaaagaagatttgtttgagatggattcattagca
ttgcacagtgttacaatggggaaggtggatgcaataaatgcagctggagctgaaggagac
aaatttgaggtggatctgtctgcgctcgcgtcgaacaattcaatgatagaggcagttaat
gtgatggatgaagctaaggctatagaagacacactcgaggtggatttgtcaggaaatgct
acaagcagttcaacatatggggaagttaaatttgaggtggattcattaggaaatacttca
agcactgtaatgtatgggccagcggatggagcgtatgaacctcggtccgatgaagtcact
tttaaggtggattcatcagaaaatgcgtcaaacaatgtaatgtatgggagagcagatgtg
gtggatgaatcttgggctgatgaaggcatatttgaggtggatttttttacaaatgcttca
agcggcgcagaatatggaaaagtggatgtggtggatgaagctaaaactgatgatttcaca
tttgagattgattcattagaaaaagattcaaacaataaaatgcatgggaaagctcatatg
gtggatgaagcttgggacgatgaagccatatttgaggttgatttgtttggaaatgcttca
agcattccgatatatggggaggtgaatgtgttggatgaagctcgggctgatgatggaaaa
tttgaggttgacttattagggaatacttctagcaattcaacacatgaggaagtggatgtg
gtagatgaagctcaaacaggtgaagccacatttgaggtggatttgcttggaaatgcttta
agcagtgcaatatataaagaagtgcctgtcatgggtggagctcaggatgatgaagttgat
gtagatttctcaataaatgcttcaatcaccgaaacagaaaaggaagcagatgcagttgat
gaagctagagttgaagatgagacatttgatatggatttagtaggtaaacagatatcaatc
gattctatgaatgatgatgtagttgaagaagggactaaacatcacagatatccaatgttg
tcttcagcattcatagaagtcaagaccattcatgaaacacctgtaagtttaaagcctgaa
cttatgtcagttgtcatggatcaggaacaagacaaaccaatttccagcgtttatcaacaa
gaaggatcaatttttaatttgcatgcagaaaaccaatcaacggtagattttcatgaacgg
gagcaaatggctattacttttgataaacaaaaggaatcagttgctaaactctctaaagaa
gaccaacagactgctggtttacctgagcaaaacatgtcctttgatggtgtccataggaaa
agccagtcaattattgggctcccatttcaacaccaatcaattgttagttcccctgaaaaa
taccgatcaattgtgggttttcatggacaaaatcaatcaatcatcagctctcataaacaa
gacaaatcaattgttggtgttcctaaaaaaattcaatccattgttggttccactaagcat
gatgattcaattgttggtttccgcaaacaagacagatcaattgttagtgtgcctgagcaa
aaacaatcaatagttggttttcataaacaagatctatcaattgttgctgtcagcgaacaa
aatctatcaattgttgctatacctagagagagtcaatcaaagcaaatttctattgttcgg
agacatgatccactacatttgaaggaagtggaaacaaaggatagagatggcatatctaaa
aaatctggtggtgacgatgatttgccacatatgctcttcgaagaagagctttcacaggtt
gaagatgtagcaagggcaatcgcctataaaaagcagcatgaagttgatgtaatctctttg
actccagatatccaggagtcaccacaggacaatatcgacccacaagaactccgaaggatg
ctccaagaacttgctgaccagaattgttcaatgggtaacaagcttttcgtttttccagag
gcagtgaaggctaattcgacaattgatgtatatttgaatcgtaacctatcggctttggcg
aatgagcctgatgtccacatcaaaggagcattcaatagttggagatggaggcctttcacc
gaaagactgcacaagagtgaattgagtggggattggtggtcttgcaaactgcacataccc
aaggaagcttatagattagactttgtgttcttcaatggtcgtttagtctatgataacaat
gatagtaatgattttgtgctgcaagtagaaagtacaatggatgaagattcctttgaggag
ttcttggttgaagaaaagaaaagagaacttgagagagttgccactgaagaagctgaaagg
aggaggcatgctgaagagcagcagcgaatgggagaacaaagggctgcagaacaagctgcc
agggaacaggctaagaaggagatagagttgaagaagaacaaattgcaaaatctgttgagt
tcagccagaacacatgttgataatttgtggcacatagagcctagcacatatagacaaggg
gacactgtcagattgtactataacagaaactcaaggccgcttatgcatagtactgagatc
tggatgcatggtggttgcaatagttggactgatggactctctattgttgaaagacttgtc
gaatgtgatgacgaaaatggtgattggtggtatgctaatgttcatatacctgaaaaggcc
tttgtattggactgggtttttgctgacgggccacctggaaatgcaaggaattatgacaac
aatggtcgacaagattttcatgctattcttccaaatgccatgactaacgaagaatattgg
gttgaagaggaaaactgtatctatacaaggcttctccacgagatcagagaacgggaggaa
gctattaaaataaaggttgagaaaagagcaaaaatgaaatctgagatgaaggaaaagact
atgagaatgtttctactttctcagaaacacattgtttatactgaaccacttgaaatacgt
gctggaacaactgtggatgttctatataatccttctaatacggtgctgaatggaaagcca
gaggtttggtttaggtggtcctttaaccgatggatgcatccaagtggtgttttaccaccc
aagaagatggtgaaaacagaagatggttgtcacttaaaagcgacagttagtgttccatcg
gatgcttatatgatggactttgttttctctgagtcggaagaaggtggaatctatgacaac
aggaatgggacagactatcatattcctgtttctggttccaatgcaaaggagcctcccatt
catattgtccatatagcggttgagatggcacccattgcaaaggttggaggccttgctgac
gttgtcacaagtctttcacgtgcaattcaagagttaggccatcatgttgaggttattctc
ccgaaatataattttatgaatcaaagcaatgtgaagaatttgcatgtacgtcaaagcttt
tctttgggtggtacagaaattaaagtgtggtttggactagttgaagacctgtctgtttac
ttcttggaacctcaaaatgggatgtttgggggtggatgggtatatggagggaacgatgct
ggcagatttggcttgttctgtcagtctgctctagagttcctccttcagagtggatcttct
ccacatataatacactgccatgattggtcaagtgcaccagttgcctggctatacaaggaa
cactatgcagaatccaggttggcaactgcccggattatatttaccatccataatcttgag
tttggagcacattttattggaaaagcaatgacatactgcgacaaagccacaactgtttct
cacacgtattcaaaggaagtcgcaggtcatggtgccatagctcctcatcgtggaaaattc
tatggaattctcaatggaattgatccagatatctgggatccatatactgataacttcatc
ccgatgcattatacttctgaaaatgtggttgaaggcaagaatgctgcaaagagagcattg
cagcagaggtttggactgcagcagactgatgtccccattgttggaatcatcactcgtctg
acagcccagaagggtatccacctcattaaacatgcacttcatcggacacttgaacgcaat
ggacaggtggttttgcttggttcagctccagatcctcggatacagagtgatttctgcaga
ttggctgatagtcttcatggtgaaaaccatggcagggttagactatgtttaacttatgac
gagcctctctcacacctgatatatgctggctctgacttcatccttgttccatccatcttt
gaaccttgcggtttgactcaacttgttgccatgcgctatggatccatccctattgttcgg
aaaaccggaggactttacgacactgttttcgacgtagaccatgacaaagaccgggctcga
gttctaggccttgaaccaaatgggttcagctttgatggagctgactgtaatggtgtggat
tacgccctgaacagagcaatctcttcttggtttgaagcccgcggttggttccactccctc
tgcaaaagggtcatggagcaagactggtcctggaaccggcctgccctggactacattgaa
ctgtaccattcagctcacaaattttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269493
Entry
9269493           CDS       T01015                                 
Name
(RefSeq) soluble starch synthase 1, chloroplastic/amyloplastic
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    9269493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9269493
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     9269493
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   9269493
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 9269493
NCBI-ProteinID: XP_015644241
UniProt: Q0DEC8
LinkDB
Position
6:complement(3079058..3086803)
AA seq 641 aa
MATAAGMGIGAACLVAPQVRPGRRLRLQRVRRRCVAELSRDGGSAQRPLAPAPLVKQPVL
PTFLVPTSTPPAPTQSPAPAPTPPPLPDSGVGEIEPDLEGLTEDSIDKTIFVASEQESEI
MDVKEQAQAKVTRSVVFVTGEASPYAKSGGLGDVCGSLPIALALRGHRVMVVMPRYMNGA
LNKNFANAFYTEKHIKIPCFGGEHEVTFFHEYRDSVDWVFVDHPSYHRPGNLYGDNFGAF
GDNQFRYTLLCYAACEAPLILELGGYIYGQKCMFVVNDWHASLVPVLLAAKYRPYGVYRD
ARSVLVIHNLAHQGVEPASTYPDLGLPPEWYGALEWVFPEWARRHALDKGEAVNFLKGAV
VTADRIVTVSQGYSWEVTTAEGGQGLNELLSSRKSVLNGIVNGIDINDWNPSTDKFLPYH
YSVDDLSGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIKLAIPDLMRDNIQF
VMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPCGLNQL
YAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKMLWALRMAISTYRE
HKSSWEGLMKRGMSSDFTWDHAASQYEQIFEWAFMDQPYVM
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggcgacggcggcggggatggggatcggggcggcgtgcctggtggcgccgcaggtgagg
ccggggaggaggttgcggctccagcgggtgcggaggcggtgcgtggcggagctgagcagg
gacggtgggtcggcgcagcgcccgctggcaccggcgccgctggtgaagcagccggtcctg
ccgaccttcctcgtgccgacgtcgacgccacccgcgcccacgcagtcgccggcgccggcg
ccgaccccgccgccgttgccggactccggcgtgggggagatcgagcccgatctagaaggt
ctcacagaagattccatcgacaaaacaatttttgtggctagtgagcaggagtctgagatc
atggatgtgaaggagcaagctcaagctaaagtaacacgcagcgttgtctttgtaaccggt
gaagcttctccttatgcaaagtcaggtggactaggagatgtttgtggttcactgccaatt
gctcttgctcttcgtggtcatcgtgtgatggttgtaatgccgagatacatgaacggggcc
ttgaacaaaaattttgcaaacgcattttacactgagaagcacattaagattccatgcttt
ggcggagaacatgaagttactttttttcacgagtatagggattctgttgattgggtgttt
gttgatcatccctcatatcatagacctggaaatttgtatggagataattttggtgctttt
ggcgataatcagttcagatacacactcctgtgctatgcggcgtgtgaagccccattaatt
cttgaactgggaggatatatctatggacagaaatgcatgtttgttgtgaatgattggcat
gccagtcttgtgccagtccttcttgctgcaaaatatagaccatatggtgtttacagggat
gcccgcagtgttcttgtcatacataatctagcacatcagggtgtggagcctgccagtaca
tatcctgacctgggattgccacctgaatggtatggagcattagaatgggtgtttccagag
tgggcaaggcggcatgcccttgacaagggtgaggcagtcaattttttaaaaggcgcagtt
gtgacagcagatcgaattgtgactgtcagccaggggtattcatgggaggtcacaactgct
gaaggtgggcaaggcctcaatgagctcttaagctcccggaagagtgtattgaatggaatt
gtaaatggaattgacattaatgattggaacccatccacagacaagtttctcccttatcat
tattctgttgatgacctgtccggaaaggccaagtgtaaagctgaattgcagaaggagctg
ggtttacctataaggcccgatgtgcctctgattggctttattggaagattggactatcaa
aaaggcattgatctaattaaacttgccattccagatctcatgcgggacaatattcaattc
gtcatgcttggatctggtgacccaggttttgaaggatggatgagatccacagaatcaggg
tacagggataaatttcgtggatgggttggatttagtgttccagtttcccaccgaataact
gcaggttgcgatatattgttgatgccatccagattcgaaccttgtggcctcaatcagcta
tatgctatgcaatatggtacagtgcctgttgttcatggaactggaggcctcagagataca
gtggagaattttaacccgtttgctgagaaaggagagcagggtacagggtgggcattctcg
ccactaaccattgaaaaaatgctgtgggcattgcggatggcaatttcgacatacagggaa
cacaagtcctcttgggagggtctaatgaagcgaggcatgtcaagcgactttacatgggac
catgccgcctcacagtatgaacagatcttcgaatgggccttcatggatcaaccatatgtc
atgtaa

DBGET integrated database retrieval system