KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324679
Entry
4324679           CDS       T01015                                 
Name
(RefSeq) serine--tRNA ligase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4324679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4324679
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4324679
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     4324679
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4324679
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4324679
 Prokaryotic type
    4324679
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N FapA RPW8 YlqD HAUS5 YabA HIP1_clath_bdg OmpH APG6_N NPV_P10
Other DBs
NCBI-GeneID: 4324679
NCBI-ProteinID: XP_015622439
LinkDB
Position
1:21175749..21179924
AA seq 445 aa
MLDINLFRTEKGGDPELIRRSQRNRSASVELVDEVIALDDQWRQRQFELDKIRQELNKTS
KEIGKLKAKKEDASALIQSTEEIKKRLAAKETEVQEAKGTLDAKLVTIGNIVHESVPVSD
DEANNLIVRTWGERRLEGNLKNHVDLCKMLDIVALEKGADVAGGRGYYLKDEGVLLNLAL
INFGLAFLRKRGFKPMQTPFFMRKETMGKCAQLAQFDEELYKLTGDGEEKYLIATSEQPL
CAYHLGDRIYPAELPIRYAGYSTCFRKEAGSHGRDTAGIFRVHQFEKIEQFCVTSPNDNE
SWEMHEEMIKNSEDFYKEIGLPYQLVSIVSGALNDAAAKKYDLEAWFPASKTYRELVSCS
NCTDFQARRLGIGYGQKKNDEQSKQFVHMLNSTLTATERTLCCILENFQKENGVEVPKAL
QPYMGGIDFLPFKLDSKQVARLQIK
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgctcgacatcaacctcttccgcacggagaagggcggcgacccggagctgatccgcagg
tcgcagcgcaaccgctccgcctccgtcgagctcgtcgacgaggtcatcgccctcgacgac
cagtggcgccagaggcaattcgagctcgacaaaatccggcaggagctcaacaaaaccagc
aaggaaatcggcaagctcaaggctaaaaaggaggacgcgtcggctctgattcagagcacg
gaagagattaagaagaggttggctgccaaggagacggaggtgcaggaggccaagggcacg
ctcgatgccaagctcgtgacgattggaaacattgtgcatgaatccgtccctgtcagcgat
gacgaggctaacaatttaattgtacggacatggggagagaggaggctggagggtaatttg
aagaatcacgtggatctttgtaagatgcttgacatagtagctttggagaaaggtgctgat
gtagcaggtggaaggggttactatttaaaggatgaaggtgtcctactgaacttggcattg
ataaattttggactcgcttttctgagaaagcgaggcttcaagccaatgcaaactcctttt
ttcatgagaaaggaaaccatgggaaaatgtgcccagttggcccaatttgacgaagagctt
tacaagctaacaggcgatggagaggaaaagtatctcatcgctacatccgagcaaccgctg
tgtgcgtatcatctaggtgatcgaatttatcctgctgaattgccaattagatatgctgga
tattccacctgcttccggaaagaagctggttcacatggaagggacacggctggtatcttc
agagtccaccaattcgaaaagattgagcaattctgtgttacaagtccaaatgacaatgaa
tcctgggagatgcatgaagaaatgataaaaaattcagaagatttctacaaggagattggc
ctaccgtaccaacttgtctccattgtgtctggtgctcttaatgatgctgcagctaagaag
tatgatttagaagcatggttccctgcatcaaaaacctatagggaattagtgtcctgctca
aattgcacagattttcaagcaaggagacttggtataggttatggccagaaaaagaatgat
gagcaatccaagcaattcgttcatatgttgaactcaacattgactgccactgagaggacc
ctttgctgtattttggagaacttccagaaggagaatggtgtcgaagttccaaaagcattg
cagccttacatgggtggaatcgatttccttcctttcaagctggatagcaaacaagttgct
cgactccaaatcaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350906
Entry
4350906           CDS       T01015                                 
Name
(RefSeq) serine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4350906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4350906
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4350906
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     4350906
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4350906
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4350906
 Prokaryotic type
    4350906
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N DUF244
Other DBs
NCBI-GeneID: 4350906
NCBI-ProteinID: XP_015615389
UniProt: Q2R1C1 Q0IRN7
LinkDB
Position
11:23628177..23632509
AA seq 509 aa
MLTCGRFLSSSAAASTPSLSPFRNLTLSLLRRPHLRLLSSSATASAAAAAVEPDTKGGAG
GGAAKPQWKAAIDFKWIRENTDAVAANIRDRNSAANLDLVLQLYDEYLALQKEVERLRAE
RNAVANKMKGKLEPSVRQALVEEGKNLKEGLIALEEDLVQLTDKLQLEAQSIPNTTHPDA
PVGGEESSVVRKEVGSQRNFNFTIRDHLQLGKELDLFDFDAAAEVSGSKFYYLKNEAVLL
EMALVNWAITEVSKKGFTPLITPEIVRSSVVEKCGFQPRAQNTQVYSIDNSDQCLIGTAE
IPVGGIHMDSILPDSDLPRKYVAYSHCFRTEAGAAGAATRGLYRVHQFSKVEMFVFCRPE
ESDKCHEELITIEEELYASLGLHFKTLDMATGDLGAPAYRKFDIEAWMPGLDRYGEISSA
SNCTDYQSRRLGIRFRPSPADPPPANAKKGKGSSGPTQFVHTLNATAVAVPRLIICILEN
FQQEDGTVVIPEPLRPFMGGLEVLSPKTK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctgacctgcggccgcttcctctcctcctccgccgccgcctccaccccctccctctcc
cccttccggaacctaaccctctccctcctccgccgtccccatctccgcctcctctcctcc
tccgccaccgcctccgccgccgccgccgccgtcgagcccgacaccaagggtggcgcgggt
ggcggcgccgcgaagccgcagtggaaggcggcgatagacttcaagtggatccgggagaac
acggacgccgtcgccgccaacatccgcgaccgcaactccgccgccaacctcgacctcgtc
ctccagctctacgacgagtacctcgccttgcagaaggaagttgaacggctccgagctgaa
agaaatgcagttgctaataagatgaaagggaaattagaaccatctgtgcgtcaagccctt
gttgaagaaggcaagaacctgaaagaagggcttattgccctagaagaggaccttgttcag
ctgactgataagcttcaactagaagcacaaagcattcctaacaccacacatccagatgct
cctgtagggggtgaggaaagttctgtcgtcagaaaagaggttggtagtcagagaaacttc
aatttcaccattagagatcaccttcagctgggaaaagaacttgatttgtttgattttgat
gcagctgctgaggttagtggctcgaagttctactacttaaagaatgaagctgttctgttg
gagatggcccttgttaattgggccatcactgaggtctcaaagaaaggtttcacaccacta
ataactccggagattgtaaggtcatctgttgttgagaaatgtggcttccagccaagggcc
caaaatactcaggtttattcgatcgataacagtgatcagtgcctcataggaactgcagag
attcctgttggcggcatccatatggactctatactccctgattctgatttgcctcgaaaa
tatgtagcctattcacattgttttcgcacagaagctggtgccgcaggtgctgccactagg
ggcctctaccgtgtacatcagtttagcaaggttgagatgtttgtattttgccggccagag
gagagcgacaagtgccatgaagaacttatcactattgaagaggaactttatgcatcactt
ggacttcatttcaaaactttggatatggcgactggggatctgggagcaccggcctacaga
aagtttgacattgaggcatggatgccaggcctagataggtacggtgagatctcgagcgcg
tcaaactgcacagactatcagagcaggcggctgggcatccggtttcgcccatcacctgca
gatcctccaccggcgaacgccaagaaaggaaagggcagctcaggcccaacacagtttgtc
cacacgctcaacgcgacagcggttgctgttcctcgcttgatcatatgcatcctggagaac
tttcagcaagaagatggaacggttgtgatcccagagccactgaggcccttcatgggcgga
cttgaagtgctctccccgaaaaccaaatga

DBGET integrated database retrieval system