KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324687
Entry
4324687           CDS       T01015                                 
Name
(RefSeq) vesicle transport v-SNARE 13
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4324687
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324687
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    4324687
SSDB
Motif
Pfam: V-SNARE V-SNARE_C Sec20 Prominin Spectrin SNARE DUF5964 KxDL Pox_EPC_I2-L1
Other DBs
NCBI-GeneID: 4324687
NCBI-ProteinID: XP_015622901
UniProt: Q8S9S2 A0A0P0V436
LinkDB
Position
1:21275583..21278815
AA seq 221 aa
MADVFEGYERQYCEISASLARKCTAASALQGEKLKQKASEIKSGIDGAEALIKKMDLEAR
NQQPSVRAGLLAKLREYKSDLNNLKGTLKRVTTGNAQQGSREELLESGMAETLGVSADQK
SRLLRITEKQNKTTDRIRDSHRTMLETEDLGVSLLQDLHQQRERLIHAHGTLDNVDDNIG
KSRRIMGAMVRRMDRNKWIIGFIIALLVLVILVILYFKFVH
NT seq 666 nt   +upstreamnt  +downstreamnt
atggccgacgtgttcgagggctacgagcgccagtactgcgagatctccgcctccctcgcc
cgcaagtgcaccgctgcctccgctctccaaggagagaagctgaagcagaaggcgtcggag
atcaagtctggcatcgatggggccgaggcactgataaagaagatggatcttgaagcaagg
aaccaacagccaagtgtgagggctgggctgctggcaaaactgagggagtacaagtcagat
cttaacaacctgaaaggaacgttgaagagggtcaccaccggtaacgcgcagcaagggtcg
agggaagagttgctggagtcaggaatggctgaaacgttgggggtatctgctgatcaaaag
tcaagattgctcaggataactgaaaagcaaaataaaacaaccgataggatcagagatagc
cacagaactatgctggagactgaagatcttggagtctccctcttgcaggacctgcatcaa
cagcgtgaacgtctaatacatgctcatggcacattggataacgtggatgacaacatcggg
aagagtagaaggatcatgggtgccatggtgaggaggatggacaggaacaagtggatcata
ggtttcattatagctctccttgtgttggtgatcctagtaatcctgtatttcaagtttgtg
cactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327678
Entry
4327678           CDS       T01015                                 
Name
(RefSeq) vesicle transport v-SNARE 13
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4327678
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327678
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    4327678
SSDB
Motif
Pfam: V-SNARE V-SNARE_C Sec20 Peptidase_C101 DUF3827 Prominin BORCS6 DUF5798 IFT57 V_ATPase_I Cauli_AT
Other DBs
NCBI-GeneID: 4327678
NCBI-ProteinID: XP_015621845
UniProt: Q8S0N4 A0A8J8YJX4
LinkDB
Position
1:29364532..29367944
AA seq 221 aa
MSEVFEGYERQYCEVSASLFRKCTTASALDGEKKKQKLSEIQSGVEEAESLIRKMDLEAR
SLQPSVKAGLLAKLREYKSDLNNLKSELKRISAPNARQATREELLESGLADTLAASTDQR
GRLMMTTERLNQSNDKIKESRRTILETEELGVSILQDLHQQRQSLLHAHTTLHGVDDNVG
KSKKILAAMSKRMDRNKWIIGGIIAALVLAILLILYFKLAY
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagcgaggtgttcgagggctacgagcggcagtactgcgaggtgtccgcctccctcttc
cgcaagtgcaccaccgcctccgccctcgatggagagaaaaagaagcagaagctgtccgag
attcagtccggcgtggaggaggctgagtcgctgattcggaagatggacctggaggcgagg
agcctacaaccgagcgtgaaggccggtttgcttgcgaagctgagggagtacaaatctgac
ctcaacaatctcaagagtgagcttaagaggatctcggcgcccaatgcaaggcaggctaca
cgggaggagctccttgagtcaggcttggctgacactctcgcggcgtctactgatcagagg
ggaagattgatgatgacaacagaaagactgaatcagtccaatgataagattaaagagagc
cgaagaaccatattggagacagaagaacttggtgtgtcaattcttcaggatcttcatcaa
caacggcagtcactgctgcacgctcatactactttgcatggggttgatgataatgttggc
aagagtaaaaagatcctggcggcaatgtcaaagaggatggacaggaacaagtggatcatt
ggggggataattgcagctcttgttctagccatccttctcatactgtactttaagctcgct
tattga

DBGET integrated database retrieval system