KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324695
Entry
4324695           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase MIEL1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4324695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324695
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4324695
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4324695
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_5 zf-RING_UBOX Prok-RING_4
Other DBs
NCBI-GeneID: 4324695
NCBI-ProteinID: XP_015611800
UniProt: Q5JL96
LinkDB
Position
1:complement(29965279..29970780)
AA seq 302 aa
MGAMDVQLESTAVQHGQAKINVEEHALVSLLSDEKYATEKTEDVDPDDYEKLEEGIMQYG
CAHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDAVKRHELPRHEVQQVICSLCGTEQE
VRQVCISCGVCMGKYFCEVCKLFDDDVSKQQYHCNGCGICRIGGKENFFHCSKCGCCYSI
VLKNSHACVEGAMHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQFACPLCS
KSVCDMSKAWERLDEELATISDTCDNKMVRILCNDCGATSEVQFHLIAHKCQKCKSYNTR
QI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgggcgccatggacgtacaacttgagtctactgctgttcaacatggacaagctaagata
aatgtggaggaacatgctctagtttctctgttgtctgatgagaagtacgcaactgaaaag
accgaagatgtggaccctgatgattatgagaaacttgaggaagggataatgcagtatggg
tgtgcacattatcgaagaaggtgccgcattcgagctccatgttgcaacgagatttttgat
tgtcggcattgccacaatgaaacaaagaattcaattaaaattgatgctgtgaagaggcat
gaactcccacgccatgaagtgcagcaggttatatgctcgttgtgtggcacggaacaagag
gtacggcaagtatgtatcagttgtggtgtatgcatggggaagtacttctgtgaagtgtgc
aagctctttgatgatgatgtttcaaaacagcaatatcattgcaatggttgtggaatatgc
agaattggtggcaaggagaatttctttcactgctcaaaatgcggatgctgttattctata
gtattgaagaacagtcatgcatgtgttgaaggagcgatgcatcatgactgtccaatctgc
tttgagtacctttttgaatcaaccaatgatgtttccgtcttgccctgtggtcataccatt
catgtcaagtgcttgcgagaaatggaggagcactgccaatttgcttgcccgctttgctct
aaatctgtctgcgacatgtcgaaggcatgggagagattggacgaggaactagcaacgata
tctgacacctgtgacaataaaatggtgcgcatattgtgcaacgattgtggggcaacatca
gaggtgcagttccatttgattgcgcacaagtgccagaagtgcaagtcctacaacacccgc
cagatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331606
Entry
4331606           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase MIEL1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4331606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4331606
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4331606
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4331606
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_UBOX zf-RING_2 zf-RING_4 HypA FUSC-like
Other DBs
NCBI-GeneID: 4331606
NCBI-ProteinID: XP_015628710
LinkDB
Position
3:2548579..2552719
AA seq 415 aa
MLRDPLSPSFFSSSLNRAAPRLPKYITVGAAVRRAVRAAGAGRARARSLGQSVSLREERG
DPWQAWRTTRCRPSAAAAAAAVSCRGREIIGLAGGRRTQVLRATIPENSVSGSSVRGKLR
EMEMDLAVEQYGCVHYRRKCKIRAPCCGEIFDCRHCHNEAKDSLEVSISDRHEIPRHEIK
LVICSLCNKEQDVQQDCSNCGACLGKYFCAKCNFYDDDVSKNQFHCDGCGICRQVVLNMH
SCDGVMKYEPFLINLTITFYRTGGAENFFHCDKCGCCYSYVLKDSHHCVERAMHHNCPVC
FEYLFDSTKDISALHCGHTIHLECLYEMRSHQQFSCPVCLRSACDMSHAWQKLDQEVAAS
PMPVIYQKKMIWILCNDCGTTSNVQFHILGHKCPGCSSYNTRQTRAAPAAACSRV
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgctacgcgaccccctctccccctcgtttttctcctcttctttaaaccgcgccgcgccg
cgcctacccaaatatataaccgtgggtgcagccgtgcgccgagccgtgcgtgcagcaggc
gcaggccgtgctcgtgctcgctcgctcgggcagtcggtctccctccgcgaggagagagga
gacccttggcaagcgtggaggacgactcggtgccggccgagtgcggctgctgctgctgcg
gctgtctcctgccgtggccgcgaaatcatcgggttggccggtggtcggcgcacgcaggtg
ctaagagctacaatacctgagaattcagttagtggatcatcagttcgaggaaagctgcga
gaaatggagatggacttggcagtcgagcagtacggatgcgtgcattacaggaggaaatgc
aagataagggcgccctgctgcggcgagatcttcgattgcaggcactgccacaacgaagcg
aaggactcgttggaggtcagcatcagcgaccggcacgagatccctcgccatgaaatcaag
ctggttatctgctctctctgcaacaaagaacaggatgtacaacaggattgctccaattgt
ggggcatgcttgggtaaatatttctgcgcaaaatgcaacttttatgatgacgatgtatca
aagaaccaatttcactgcgatggatgtggcatatgcaggcaagttgtgctaaatatgcat
tcctgtgacggagtaatgaaatatgagccctttttgataaatctcaccatcacattttac
agaactggtggtgcagagaacttctttcactgtgacaaatgcggatgctgctacagctat
gtgctgaaggattcccatcattgtgtggaaagagcaatgcaccataactgccctgtatgc
ttcgagtatctatttgactcaacaaaagacatcagtgcactgcactgcggacacacgatc
catctggaatgcctatacgagatgagatcccatcaacaattctcttgcccggtctgcctg
aggtctgcttgtgacatgtcccatgcatggcaaaagcttgatcaagaggttgcagcatcg
ccgatgccagtgatctatcagaagaaaatgatatggatcctatgcaacgactgtgggacg
acatcgaacgtgcaattccacatattgggacacaagtgccccggatgcagctcttacaac
acccggcagacaagagccgcccctgctgccgcgtgctccagagtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332833
Entry
4332833           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase MIEL1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4332833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4332833
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4332833
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4332833
SSDB
Motif
Pfam: zf-CHY zinc_ribbon_6 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4_4
Other DBs
NCBI-GeneID: 4332833
NCBI-ProteinID: XP_015628865
UniProt: Q10LI1
LinkDB
Position
3:complement(13095808..13098317)
AA seq 260 aa
MELDDASRHGFGRMGFGCKHYRRRCRIRAPCCNDVFHCRHCHNESTKDGHELDRHAVESV
ICLVCDTEQPVAQVCYNCGVCMGEYFCSACKFFDDDVDREHFHCQDCGICRVGGKDNFFH
CEKCGSCYSVSLRDKHCCIENSMKNNCPICYEYLFDSLRETSVLRCGHTMHLQCFHEMLK
HDKFSCPICSMPIFDMDKFLRALDAEIEANMLHIDYMGKGWIVCNDCRDTTQVYARVAGH
KCCHCQSHNTCRVAAPVLPA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggagctcgacgacgcgtctcgccacggattcggcaggatgggatttggatgcaagcac
tacaggaggaggtgcaggatccgggcgccgtgctgcaacgacgtcttccactgccgccat
tgccacaacgagtccacgaaagacggccacgagctcgatcggcacgcggttgaatcggtt
atctgtctcgtctgtgacaccgaacagccggttgcgcaagtgtgctacaactgcggcgtt
tgcatgggcgagtacttctgcagcgcgtgcaaattcttcgacgacgacgttgacagggaa
cacttccactgccaagattgcggcatctgcagagttggagggaaggataacttcttccac
tgcgaaaaatgtggatcatgctactcggtcagcctgcgcgacaagcactgctgcatcgag
aactccatgaagaacaactgccccatctgttacgagtatctgtttgactctctaagggag
acgtccgtgctcagatgtgggcacacgatgcacctgcaatgcttccacgagatgctgaag
cacgacaagttctcttgtcccatatgctcgatgcctatctttgacatggacaagttcttg
agggctttggacgctgagattgaagcaaatatgctgcacatagattacatgggaaaggga
tggatcgtgtgcaacgactgcagggacacgacgcaggtgtacgcgagggtggcagggcac
aagtgctgccattgccagtctcacaacacctgcagggtggctgccccggtgctccctgct
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348796
Entry
4348796           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase MIEL1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4348796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4348796
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4348796
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4348796
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 4348796
NCBI-ProteinID: XP_015612719
UniProt: Q337P2 B9G627
LinkDB
Position
10:complement(16704956..16708503)
AA seq 266 aa
MELESEQHGCEHYTRGCRIRAPCCGEVFGCRHCHNEAKNSLEIHLNDRHEIPRHEIKKVI
CSLCDKEQDVQQYCSGCGACMGKYFCEKCNFFDDDVSKNQYHCDGCGICRTGGVDKFFHC
DKCGCCYSNVLRDSHHCVEGAMHHNCPVCFEYLFDSTKDISVLHCGHTIHLECLNVMRAH
HHFACPVCSRSACDMSDAWKKLDEEVAATPMPEFYQKKMIWILCNDCGATSNVNFHVLAQ
KCPGCSSYNTRETRGCGRPAAARSTV
NT seq 801 nt   +upstreamnt  +downstreamnt
atggaattggagtcggagcagcacggctgcgagcattacacgaggggatgcaggatcagg
gcgccgtgctgcggcgaggtgttcggctgcaggcattgccacaacgaggccaagaattcg
ctcgagatccatctcaatgaccgtcacgagatcccccgccacgaaatcaagaaggttatc
tgctctctctgcgacaaagaacaggatgtacaacagtactgttctggttgtggggcatgc
atggggaaatacttctgcgaaaaatgcaacttctttgatgatgatgtctcaaagaaccag
tatcactgcgatggatgcggcatatgcagaactggtggtgtggataagttctttcactgc
gacaaatgcgggtgttgctacagtaatgtcttgagggattctcatcactgtgtagaagga
gcaatgcatcacaactgtcctgtctgcttcgagtacctatttgactcgacgaaggacatc
agcgtcttgcactgcgggcacacgatccatctggaatgcctgaacgtgatgagagcgcat
catcacttcgcttgcccggtgtgctcacggtcggcctgcgacatgtcggacgcgtggaag
aagctcgacgaggaggtggccgcgacgccgatgccggagttctaccagaagaagatgata
tggatcctctgcaacgactgcggcgcgacgtcgaacgtgaacttccacgtcctggcgcag
aagtgccccggatgcagctcctacaacacccgggagaccagaggctgcggccgccctgca
gccgcgcgctccacggtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352424
Entry
4352424           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase MIEL1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4352424
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4352424
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4352424
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4352424
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_4 Clavanin
Other DBs
NCBI-GeneID: 4352424
NCBI-ProteinID: XP_015618332
UniProt: A0A8J8YK94 Q2QP88
LinkDB
Position
12:21456305..21459895
AA seq 292 aa
MGGAHFPGEGEVVAGEGDAVVPLRDVGKMEHGCEHYRRRCKIVAPCCGEVFACRHCHNDA
TASGDRHTICRQDVEKVVCLLCDTEQPVSQVCINCGVNMGEYFCDVCKFYDDDTEKGQFH
CYDCGICRVGGKENYFHCAKCGSCYAVALRDNHQCVENSMRQNCPICYEYLFDSLKGTRV
LDCGHTMHMECFSEMVEHNKYTCPICSKTALDMTHHWALLDQEIEATIMPPVYRYKVWVL
CNDCNKVSEVDFHVIGHKCSHCNSYNTRSTSRPADLSGSSSPSTSDSSENNP
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggaggggcgcacttccccggtgagggcgaggtggtggccggggagggcgacgccgtc
gtccccctccgcgacgtgggcaagatggagcacgggtgcgagcattacaggaggagatgc
aagatcgtggcgccctgctgcggcgaggtgttcgcttgccgccattgccacaacgatgcc
acggcttcaggtgatcggcataccatttgccgccaggatgttgaaaaagtagtatgtcta
ctctgtgatactgaacagccggtgtcacaagtgtgcataaactgtggtgtcaatatggga
gagtacttttgtgatgtatgcaagttttatgatgatgatacagagaaagggcagtttcat
tgctacgattgtggcatatgcagggttggtggcaaggaaaactacttccactgcgcaaag
tgcgggtcttgttatgctgttgctctgcgtgataaccatcagtgtgtggagaactcaatg
aggcagaattgcccaatttgttatgagtatctatttgattcattaaaaggaacacgagtt
ctcgactgtggacacacgatgcacatggaatgcttttctgagatggtggaacataacaaa
tacacttgtccaatatgctccaagacagctcttgatatgacacatcactgggcattgtta
gatcaagagattgaagcaacaatcatgcctcccgtctaccgttacaaggtttgggtgctc
tgtaatgactgcaacaaggtctcagaagtggacttccatgtgattggccacaagtgcagc
cactgcaactcgtacaatactcgatcgacatcacggcctgcggatttatcaggaagcagt
tctccctcgacgtcagattcgtccgaaaacaatccgtag

DBGET integrated database retrieval system