KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324712
Entry
4324712           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 54 kDa protein 2
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4324712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4324712
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     4324712
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4324712
  Eukaryotic Sec-SRP protein
   4324712
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N cobW AAA_33 Zeta_toxin SRPRB MMR_HSR1 CLP1_P AAA_17 APS_kinase AAA_30 AAA Fe-ADH AAA_22 AAA_16 AAA_24 DO-GTPase2 ResIII ATP_bind_1 CbiA
Other DBs
NCBI-GeneID: 4324712
NCBI-ProteinID: XP_015621502
UniProt: Q8S1I8 A0A0P0V8S7
LinkDB
Position
1:32652482..32656593
AA seq 496 aa
MVLAQLGGSISRALAQMSNATVIDEKVLSDCLNEISRALLQSDVQFKMVRDMQSNIKRIV
NLETLAAGTNKRRIIQQAVFTELCNMLDPGKPSFTPKKGKPCVVMFVGLQGSGKTTTCTK
YAYYHQRKGFKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYMESDPVKIAVEGVERFK
KENCDLIIVDTSGRHKQEAALFEEMRQVSEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV
SVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHIDEFEVFDVKPFVSRLLGMGDW
SGFMDKIHEVVPTDQQPELLQKLSEGTFTLRLMYEQFQNILKMGPIGQVFSMLPGFSSEL
MPKGHEKESQAKIKRYMTMMDSMTDGELDSTNPKLMTESRILRIARGSGRPVRDVVDMLE
EYKRLAKIWSKMKGLKIPKKGEMSALSRNMNVQHMSKVLPPQMLKQIGGMGGLQSLMKQM
GSKEMGGMFGGMGGDK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggtgctcgcgcagctcggcgggagcatctcccgcgcgctggcgcagatgagcaacgcc
accgtgatcgacgagaaggtgctcagcgactgcctcaacgagatctcgcgcgcgctcctg
cagtccgacgtccagttcaagatggtccgcgatatgcagtccaacatcaagcgcatcgtc
aacctcgagacgctcgccgccgggaccaacaagcggcgcatcatccagcaggccgtcttc
acggagctctgcaacatgttggatcccgggaagccttccttcactcccaagaaggggaaa
ccttgcgtggtcatgttcgttggtttgcaaggttctggtaaaactactacttgtaccaaa
tatgcatattatcatcagcgcaagggatttaagccagcacttgtttgtgctgatacattt
agggctggtgcttttgatcagttaaaacagaatgcaacaaaggccaagattcctttttac
ggaagctacatggagtctgatccagtgaaaattgctgttgagggtgtggagaggttcaag
aaagaaaactgtgatctcatcattgtagatacgagtggaaggcacaaacaagaagcagcc
ctttttgaagaaatgcgccaagtttcagaagcgacgaaaccagatctggtaatatttgtg
atggacagtagtatcggtcaggctgcatttgatcaggcacaagcatttaagcaaagtgtt
tctgttggtgctgtgattgtcactaaaatggatggccatgcgaaaggaggtggcgcactt
agcgcggttgcagcaacaaaaagtccagtgatatttattggaacaggagaacacatcgat
gagtttgaagtttttgatgtgaaaccatttgtcagtcgtcttttaggcatgggagactgg
tcggggtttatggacaagattcatgaagtagtacccactgatcaacaacctgagcttttg
cagaagctgtctgaaggaaccttcactctgagacttatgtatgagcagttccagaacatc
ttgaaaatgggtcctattggccaggttttctcaatgttgcctggatttagttctgaattg
atgccaaagggacatgagaaggaaagccaagctaagattaaacggtacatgacgatgatg
gattccatgacagatggagagcttgacagcacaaatcctaaattgatgactgaatcgcgt
attcttcggattgctcggggatctggccgacctgtcagagatgttgtcgacatgctcgaa
gagtacaagcggcttgctaaaatctggagcaagatgaaagggctcaagataccaaagaaa
ggagaaatgagtgcactgtcccgcaacatgaacgttcagcacatgagcaaagttctcccg
ccgcagatgctgaagcagataggcggcatgggtggcctgcaatctttgatgaaacaaatg
ggctcaaaagaaatgggtggcatgtttggaggcatgggtggtgataagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339274
Entry
4339274           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 54 kDa protein 2
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4339274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4339274
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     4339274
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4339274
  Eukaryotic Sec-SRP protein
   4339274
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N AAA_33 cobW AAA_17 Zeta_toxin AAA_30 MMR_HSR1 AAA_16 AAA_22 DO-GTPase2 CLP1_P AAA_19 ATP_bind_1 vWA-TerF-like APS_kinase DUF373 AAA
Other DBs
NCBI-GeneID: 4339274
NCBI-ProteinID: XP_015637823
UniProt: Q7XB57 Q0DGV6
LinkDB
Position
5:complement(25229699..25233200)
AA seq 483 aa
MVLAQLGGSISRALAQMSNATVIDDKAFADCLHEIARALLQSDVQIRMVSDMRANIRRAV
NLDALPAGTNKRRIIQQAVFAELCNMLDPGKPSFTPTKGKPSVVMFVGLQGSGKTTTCTK
YAHYHQLKGFKPSLVCADTFRAGAFDQLKQNATKAKIPYYGSYMESDPVKIAVEGVERFR
KEKSDLIIVDTSGRHKQEAALFEEMRQVAEATKPDLVIFVMDGSIGQAAFDQAQAFKQSA
SVGAVIVTKLDGHAKGGGALSAVAATKSPVVFIGTGEHMQDFEVFDVKPFVSRLLGMGDL
SGLVNKIKDAMPADQQPELMQRLIEGTFTLRVFYELFQNLLNMGPIGQVLSMIPGFRSEL
MPKGHDKESQAKIKRYMTIMDSMTNAELDSTNPKLMSESRIKRVARGSGRTMKDVTDMLE
EYKRIAKVCSKLKKKLPKNMDRNVMNNKDTLNTINNLIPKQLLNQIGGVNPLQSVMKQMG
LKT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggtgctcgcgcagctgggcgggagcatctcccgcgcgctggcgcagatgagcaacgcg
acggtgatcgacgacaaggcgttcgccgactgcctccacgagatcgcgcgcgcgctcctg
cagtccgacgtgcagatcaggatggtctccgacatgcgcgccaacatccggagggccgtc
aacctcgacgccctccccgccggcaccaacaagcgccgcatcatacagcaggccgtcttc
gcggagctctgcaacatgcttgatccggggaagccgtccttcacccccaccaaggggaag
cccagtgtggtcatgttcgtcggcttgcaaggttctgggaaaaccactacctgtaccaaa
tatgctcactatcatcagctgaagggctttaaaccttcattggtttgtgctgatacattc
agagctggtgcctttgatcagttaaaacagaatgctacaaaggccaagattccttactat
ggaagctacatggaatcagacccagtgaaaattgctgttgagggtgtggagaggttcagg
aaggagaagtctgatctcatcattgttgatactagcgggcgccacaagcaagaggctgca
ctcttcgaagaaatgcgtcaagttgcagaagcaacgaaacctgaccttgtgatattcgtg
atggatggtagcattggtcaggcagcgtttgatcaggcgcaagcatttaaacagagtgct
tctgttggtgctgtgattgttacgaaattggatggtcatgccaaaggaggcggtgcactt
agcgcggttgcagctacaaagagccctgttgtatttattggaactggagaacacatgcag
gattttgaggttttcgatgtgaaaccatttgttagtcgtctgttaggaatgggagacttg
tctggcttagtgaacaagatcaaagatgctatgcctgctgatcaacaacctgagcttatg
cagagactgatagaaggaacctttactctcagagtattctacgagctgttccagaatctt
cttaacatgggtcctattggacaggttttatctatgatacctggatttaggtctgaactg
atgccaaaaggacatgacaaggaaagccaagcaaagattaagcggtacatgactattatg
gattctatgacaaatgcagagcttgatagcacaaacccaaagctgatgagtgaatcacga
attaaacgggtcgctcgaggatctggcaggaccatgaaagatgtgaccgacatgctggaa
gagtacaagagaatcgccaaggtgtgtagcaagttgaagaagaagttgcccaagaatatg
gacaggaatgttatgaacaacaaggacacgctgaacaccattaacaatctcatccctaag
caattgttgaatcagatcggtggtgttaatccgttgcagagcgtcatgaagcaaatgggc
ttaaagacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349809
Entry
4349809           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 54 kDa protein, chloroplastic
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4349809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4349809
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     4349809
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4349809
  Eukaryotic Sec-SRP protein
   4349809
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N Zeta_toxin CbiA AAA_22 ParA AAA_17 APS_kinase ArsA_ATPase CLP1_P cobW NTPase_1 AAA AAA_31 AAA_30 AAA_18 6PF2K MeaB AAA_33 AAA_16 MMR_HSR1 ATPase KAP_NTPase ATP_bind_1 Thymidylate_kin ResIII AAA_24 GTP_EFTU DUF5799 KTI12 PIF1 AAA_14 UPF0004 CBP_BcsQ DUF3829 GET2
Other DBs
NCBI-GeneID: 4349809
NCBI-ProteinID: XP_015617529
UniProt: Q53QG1 A0A0P0XZH8
LinkDB
Position
11:2517465..2521847
AA seq 557 aa
MEATSSTTLALSSPPTAAARRSPAKAIVASHHLRHSSVPALHLRAVPGPSFRALPSPGFP
GWRRKRGSGLVVRAEMFGQLTTGLESAWNKLRGTDQLTKDNIAEPMRDIRRALLEADVSL
PVVRSFIESVTEKAVGTDVIRGVKPEQQLVKVVNDELVQLMGGEVSDLVFAKTAPTVILL
AGLQGVGKTTVCAKLAYYLKKMGKSCMLIAADVYRPAAIDQLTILGKQVGVPVYSEGTEA
KPSQIAKNGIKEAKSKKTDVIIVDTAGRLQVDKAMMSELKEVKRAVNPTEVLLVVDAMTG
QEAASLVSTFNVEIGITGAILTKLDGDSRGGAALSIKEVSGKPIKFVGRGERMEDLEPFY
PDRMAQRILGMGDVLSFVEKAQEVMRQEDAEELQKKILSAKFNFNDFLKQTQAIAQMGSF
SRIIGMIPGMNKVTPAQIREAEKNLKFMESMINVMTPEERERPELLAESRERRIRVAKES
GKNERQVSQLVAQLFRMRAQMQKMMGAMQGQDTPDMEGLMDSIKAEEQAAAGTGKRRRKY
GNLRRRDLDAMRGFRRR
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggaggccaccagtagtactacactagcgctctcctcgccgcccaccgccgccgcccgc
cgctcgccggcgaaggcgatcgtcgcctcccaccacctgcgccactcctccgtccccgcc
cttcacctccgcgcggtccccggcccctccttccgcgccctcccctcacccggcttcccg
ggatggaggaggaagaggggaagcgggctggttgtgcgggcagagatgtttgggcagctc
acgaccgggctggagtccgcgtggaacaagctgcggggaacagatcaactgacgaaggac
aacatcgctgaaccaatgcgggatatcagaagagcacttttggaggcagatgtgagtttg
ccggtagtgagaagttttattgagtccgttactgaaaaagctgtaggcactgatgtgatt
cgaggtgtcaagcctgagcaacagctggtgaaggttgtgaatgatgaacttgtacagttg
atgggtggggaggtatcagatttggtgtttgcaaaaactgccccaacagttatcctattg
gcgggtctacaaggtgttgggaaaactactgtttgtgcaaagcttgcctattatctaaag
aaaatggggaagagttgcatgctgattgctgcggatgtctacaggcctgctgccattgat
caactcactattctggggaaacaggttggggttccagtttactctgaaggaactgaagct
aaaccttcacaaattgccaagaatggcataaaggaggcaaaaagcaagaaaactgacgta
atcatagtggatactgctggaaggctgcaggtagataaagccatgatgagtgagttgaaa
gaggtaaaaagggcagtaaatcctacagaagttctacttgtggtggatgccatgactgga
caagaagctgcatcattggttagcaccttcaatgttgagattggtattactggtgctata
ctgacaaaactggatggtgattccagaggtggagcagcactaagtatcaaagaggtatct
ggaaagcccatcaagtttgtagggcgaggagaacgcatggaagatcttgagcctttctat
cctgatcgtatggcacaacgaatcttgggaatgggagatgtactttcatttgttgaaaag
gcacaggaagtgatgcgtcaagaagatgctgaggaattacagaagaagatcctgagtgca
aaatttaacttcaatgacttcttgaagcaaacacaagctatcgcacaaatgggttcattt
agtcgtataattggcatgattccaggcatgaacaaggttacccctgctcaaattcgtgaa
gcggagaaaaaccttaaatttatggagtccatgatcaacgtaatgacccctgaggaaagg
gaaagaccagagctacttgctgaatcacgcgagaggaggataagagtggccaaggaatcc
ggaaaaaacgaacgacaggtgagccaattggttgcgcagctcttccgaatgcgtgctcaa
atgcagaaaatgatgggtgctatgcaagggcaagacacccctgatatggaaggcctcatg
gattccatcaaggcagaagagcaggctgccgctggtactggaaagcgaaggagaaagtat
ggcaatctgaggcggcgagacctggatgcaatgcgcggtttccgtcgacgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267495
Entry
9267495           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 54 kDa protein, chloroplastic
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    9267495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    9267495
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     9267495
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   9267495
  Eukaryotic Sec-SRP protein
   9267495
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin ParA cobW AAA_22 ArsA_ATPase AAA_33 APS_kinase AAA_18 6PF2K AAA_31 AAA_16 AAA_17 AAA_26 AAA AAA_30 DUF6779 AAA_24 NTPase_1 ATP_bind_1 AAA_25 ATPase
Other DBs
NCBI-GeneID: 9267495
NCBI-ProteinID: XP_015615546
UniProt: B9G9F9
LinkDB
Position
11:2512388..2517215
AA seq 550 aa
MEATALTLSSRPAAASRSPAKGTFASLHPRRRFSAHAVHLRAAQSASLRAPSPGARRRRR
RGSGLVVRAEMFGQLTTGLESAWNKLRGVDVLTKENIVEPMRDIRRALLEADVSLPVVRR
FVSSISEKALGSDLIRGVRPEQQLVKIVHDELVKLMGGEVSDLVFAKSGPTVILLAGLQG
VGKTTVCAKLAFYLKKLGKSCMLVAADVYRPAAIDQLTILGEQVGVPVYSEGTEAKPAQI
TKNAVEEAKRKNIDAIVMDTAGRLQIDKSMMVELKEVKKAVNPTEVLLVVDAMTGQEAAA
LVTTFNIEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKFVGRGERMEDLELFYPDRMA
QRVLGMGDVLSFVEKAQEVMRQEDAVELQKKIMSAKFDFNDFLKQSQNVAKMGSMSRVVG
MIPGMNKVTPAQIREAEKRLAFVESMINAMTAEEREKPELLAESRDRRIRVAEESGKSEQ
EVSQLVAQLFQMRAQMQKLMGVMTGQEALPGMGNLMESLNADEKAPPGTARRKRRHSKTR
QRELDAVPSS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggaggccacggcgctcacgctctcctcccgccccgccgccgccagccgctcgccggcg
aagggaaccttcgcctccctccacccccgccgccgcttctccgcgcacgctgtccacctc
cgcgcggcccagagcgcctccctgcgcgccccctccccgggggcgaggaggagacggagg
agggggagcgggctggtggtgcgggcggagatgttcgggcagctcaccaccggcctggag
tccgcctggaacaagctgcgtggcgtcgatgtactaacaaaggagaatatcgttgagcca
atgcgggatataagaagagcacttctggaagctgatgttagtttgcctgtagtgagaaga
tttgtttcgtctataagtgaaaaggctctgggttctgatcttataagaggagtccgaccg
gaacagcaattggtgaagattgtgcatgatgaacttgtaaaactgatgggtggagaagta
tcagatctggtatttgcaaaaagtggccccacagtaatcttactggcaggcctgcaaggt
gttgggaagactactgtttgcgcaaagcttgcattttacctgaagaaattgggaaagagt
tgtatgctggtcgctgcagatgtttacaggcctgcagccattgatcaactcactatactt
ggtgaacaggtcggtgtaccagtttactcagaaggaacagaagccaaacctgcacaaata
accaagaatgccgtggaagaggccaaaagaaagaatattgatgccattgtaatggatact
gctggaagactgcagattgacaaatcaatgatggttgaattgaaagaagtgaagaaggca
gttaatcctacggaagttctgcttgttgttgatgctatgactggacaggaagctgcagca
ttggtcaccaccttcaatattgagattggtatcactggtgctatattgactaaactggat
ggtgattcgaggggtggagcagcactaagtgttaaagaggtgtctggaaagcccatcaag
tttgtagggcgtggagaacgaatggaggaccttgagcttttttatcctgaccgtatggca
caacgtgttttgggaatgggcgatgtactttcatttgttgaaaaagcacaagaagtcatg
cgtcaagaagatgctgtagaattacagaagaagatcatgagtgcaaaattcgacttcaat
gacttcctaaagcaatcacagaatgttgcaaaaatgggttccatgagccgtgtagttgga
atgattccaggcatgaacaaggttactcctgcacaaattcgagaagccgagaaaagactt
gcatttgtggagtctatgatcaatgcaatgactgccgaggaaagggaaaagccagaatta
ctggctgaatcacgtgacaggaggataagagtggctgaagagtccggaaagagtgaacaa
gaggtgagccagttggttgcccagcttttccaaatgcgtgctcagatgcagaagctgatg
ggtgtgatgaccggacaagaagcacttccaggcatggggaatctcatggaatctcttaac
gccgatgagaaggcacctcctggcactgcacggcggaagaggaggcacagcaagacgagg
cagagggagctggatgcagtccctagttcttga

DBGET integrated database retrieval system