KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324713
Entry
4324713           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 4
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4324713
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4324713
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4324713
NCBI-ProteinID: XP_015621503
UniProt: Q0JIW8 Q5ZBZ6
LinkDB
Position
1:complement(32656663..32658476)
AA seq 328 aa
MGRGGDVDGAAGALRRFVREAGGCAVVDGGLATELEAHGADLHDELWSASCLVSAPHLIR
KVHLDYLDAGANIITSASYQATIQGFQARGLSRERSEALLRRSVHIAQEARAIFAEGWSK
GPYANHRSSPRRPVLVAASIGSYGAYLADGSEYTGDYGISVTKETLKSFHRRRLQVLADA
GPDLIAFETIPNKLEAQASGDPITECAAVADACARVGAVGVNCTAPRLVHGLILSIRKVT
SKPVVVYPNSGETYVAETKEWVESEGGASETDFVSCVGKWRQAGAALVGGCCRTSPATVR
AISWALRESDDAVGGDGDRDDFPAVAVL
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggtcgcgggggcgacgtggacggcgcggcgggcgcgctgcggcggttcgtgcgggaa
gcgggagggtgcgcggtggtggacggcgggctggccacggagctggaggcgcacggcgcg
gacctgcatgacgagctctggagcgccagctgcctcgtctccgcccctcacctcatccgc
aaggtgcatttggactacctcgacgccggcgccaacatcataacctcggcgtcttaccag
gcgacgatacaggggttccaggcgagaggcctgtcgcgtgagcggagcgaggcgctgctt
cgtcggagcgtccacatcgcgcaggaggcgcgcgccatcttcgccgagggctggtccaag
ggcccgtacgccaaccaccgctcctcgccgcgccggcccgtgctcgtggccgcctccatc
ggcagctacggcgcctatctcgccgacggctccgagtacaccggcgactacggcatatcg
gtgaccaaggagacgctcaagagcttccaccggaggaggctgcaggtgctcgccgacgcg
gggcccgatctcatcgcgttcgagacgatcccgaacaagctggaggcgcaggcgagcggc
gaccccatcacggagtgcgccgccgtggccgacgcctgcgcgagggtcggcgccgtcggg
gtgaactgcaccgcccccaggctggtgcacggcctgatcctctccatcaggaaggtgacg
agcaagccggtcgtcgtgtaccccaacagcggggagacctacgtggccgagaccaaagaa
tgggtggagtcggagggcggcgcgtcggagacggacttcgtgtcgtgcgtcggcaagtgg
aggcaggcgggcgccgccctcgtcgggggttgctgcaggacgagcccggccacggtgagg
gccatctcgtgggcgctgcgtgaatcggatgacgccgtgggtggtgacggcgatcgcgac
gatttccctgcagtggccgtgctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332095
Entry
4332095           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 1
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332095
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4332095
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4332095
NCBI-ProteinID: XP_015632081
UniProt: A3AFK7 Q8H825
LinkDB
Position
3:6354826..6357807
AA seq 329 aa
MAVAVEEIVRRAGGCAVIDGGFATQLEALGADINDPLWSAACLITKPHLIKEVHMQYLEA
GADVIISSSYQATIPGFLARGMLLEEAEGLLRRSIELALEARDEFWKSTLRKSKPVYNRA
LVAASIGSYGAYLADGSEYSGSYGEDITAEKLKDFHRRRLQVLASAGPDLIAFEAIPNKM
EAQALVELLEEENIQVPSWICFSSVDGKNLCSGESFAECLQFLNASDKVTIVGVNCTPPQ
FIEGIIRELKKQTKKAIAVYPNSGEIWDGRAKRWLPAQCFGHKSFDALAKRWQEAGASLV
GGCCRTTPSTIRAVSKVLKGKTSYSATQI
NT seq 990 nt   +upstreamnt  +downstreamnt
atggccgtggcggtggaggagatcgtcaggagggccggcgggtgcgccgtgatcgacggc
ggattcgccacgcagctggaggcgctcggcgccgacatcaacgacccgctctggagcgcc
gcctgcctcatcaccaagccgcacctcatcaaggaggttcacatgcaatatcttgaagca
ggtgccgatgtcatcatttcctcatcataccaggcaactatcccaggattcttagccaga
ggaatgcttcttgaggaggcagaagggttactgcgaaggagcattgaattggcactggaa
gcacgagatgaattctggaagtcgacgctgaggaagtccaagcctgtttacaaccgtgct
ctggtcgccgcatccattgggagctatggagcttaccttgccgatggctcagagtacagt
ggatcgtatggagaagacatcacggcagagaaactgaaggacttccacaggcgccggctg
caggttcttgcgagcgctggccctgacttgatcgcgtttgaggccatcccgaacaaaatg
gaggcacaggctttagttgagcttctggaggaagagaacatccaggtcccctcctggatc
tgcttcagctcagtggacggcaagaacctgtgctcaggagagagctttgcagagtgcctc
caattcctcaacgccagcgacaaggtgaccatcgtgggtgtcaactgcacgccgcctcag
ttcatcgagggcatcatacgcgagctcaagaagcaaaccaagaaggcgatcgcggtgtac
ccgaacagcggcgagatttgggacggcagagcgaagagatggctgccggcacagtgcttt
gggcacaagagcttcgacgcgctcgcgaagaggtggcaggaggccggcgcgagcttagtc
ggcggatgctgccggacgacgccgtcgacgatccgggccgtctccaaggtcctcaagggc
aagacgtcctattcagcaactcagatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348656
Entry
4348656           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 2
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348656
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4348656
SSDB
Motif
Pfam: S-methyl_trans CoA_binding
Other DBs
NCBI-GeneID: 4348656
NCBI-ProteinID: XP_015613413
UniProt: Q7XEH2 A3C4V2
LinkDB
Position
10:14921930..14925036
AA seq 335 aa
MSQQGEYHADMMAEFLRGSGGAAVIDGGLATELEANGADLKDALWSARCLFTCPDLIRKV
HLDYLEAGASVLITGSYQATIQGFLSKGFSQEESESFLRRSVELACEARAIYLEKCSNGS
DEAKDVTKYRKRPILIAASVGSYGAYLADGSEYSGDYGNEGTLEFLKNFHLRRLQVLAEA
GPDVIVFETIPNKIETQAYVELLEECKLRIPAWFGFTSKDGVNVVSGDSLIECASIADSC
KEVAAVGINCTPPRFIHELVLSIRKVTSKPILIYPNSGESYDPIRKEWVECSGISNEDFV
SYVKKWHEAGASLIGGCCRTSPDTIRGISKALHGV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtcaacaaggggagtaccacgccgacatgatggcggagttcctgcgggggagcggc
ggcgcggccgtgattgacggcgggctggcgacggagctggaggctaacggcgccgacctc
aaggacgccctctggagcgcccggtgcctcttcacctgccccgacctcatccggaaggtt
catttggactatcttgaagctggggcaagtgttctgataacaggatcatatcaggccaca
attcagggcttcctttcaaagggattttctcaggaggaaagtgaatcattcctgaggagg
agtgttgaactagcatgtgaagcacgggctatttacctggaaaaatgttctaacggttcg
gacgaagccaaagacgtaacaaaatacaggaagcgcccaatactaattgcggcatcagtt
ggttcttatggagcatacctagcagatggctctgagtatagtggtgactacggtaatgag
ggcactttggagttcctcaaaaactttcatctgagaaggcttcaagtccttgctgaagct
ggtcctgatgttattgtttttgaaactattccaaacaaaattgagactcaggcatatgtt
gaactactagaggagtgtaaattacgtattccggcatggtttggtttcacttcaaaggat
ggagtcaatgtagtaagtggtgattccctgatagagtgtgcctctattgccgattcatgc
aaggaagttgctgcagttggtattaattgcactcccccaagatttatccatgaattagtt
ttatccatccggaaggtgacaagtaaaccaatattaatatacccaaatagtggtgagagc
tatgatcctataagaaaggaatgggtggaatgctcagggatttcaaatgaggattttgtt
tcatatgtcaaaaaatggcatgaggctggggcctcactgatagggggttgctgcagaaca
agtccagatacgataagaggaatatcgaaggctctgcatggagtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352747
Entry
4352747           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 2
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352747
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4352747
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4352747
NCBI-ProteinID: XP_015620113
UniProt: Q2QME6 A0A8J8Y7K1
LinkDB
Position
12:25641847..25645420
AA seq 342 aa
MVGKSGVAEEGGAAAAAAVRRWVEAGGGRLVMDGGLATELEANGADLNDPLWSAKCLLSS
PHLVRKVHLDYLEAGANIIITASYQATIQGFESKGFSKEQSEDLLAKSVEIAREARDMFL
KEHSDRPIQHPILVAASIGSYGAYLADGSEYSGDYGEAGTLEFLKDFHKRRLEVLAEAGP
DLIAFETIPNKLEAQAYVELLDECNISIPAWFSFNSKDGVHIVSGDSLIECATIANGCSK
VGAVGINCTPPRFIHGLILSIRKVTDKPILIYPNSGERYDAEKKEWVESTGVSDGDFVSY
VNEWCKDGAVLIGGCCRTTPNTIKAISRSLNQRHSSLHLPVA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtggggaagagcggggtggcggaggagggcggagcggcggcggcggcggcggtgagg
aggtgggtggaggccggcggcgggaggctggtgatggacggcgggctggcgacggagctg
gaggccaacggcgccgacctgaacgacccgctctggagcgccaagtgcctcctctcctcc
ccgcacctcgtccgcaaggtccatttagactacctagaagcaggtgcaaatatcataatc
acagcgtcataccaggctacaattcaaggctttgaatccaagggattttcaaaagaacaa
agtgaagacttgctcgcaaagagtgttgagattgcacgtgaagcgcgtgacatgtttctg
aaggaacattcagatcgtcccatacaacatcctatcctggttgcagcttccattggaagt
tatggggcctatcttgctgacggctctgagtacagtggggattatggcgaagctggcacg
ttagaattcctgaaagattttcataagcgaaggctggaggttcttgcggaagcaggtcct
gatttgatcgcctttgaaacaattcccaacaaattggaagctcaggcttacgttgaactt
cttgacgaatgtaacatcagtatccctgcatggttctcatttaattcaaaagatggagtt
cacattgtgagtggagactcgttaattgaatgtgctactattgctaatgggtgttcgaag
gttggtgcagttggaataaattgcacacctccaagatttatccatggcctgatactctcc
attcgaaaggtcacagataagccaattctgatatatcccaacagcggagaaagatatgat
gctgagaaaaaggagtgggtggaatcaactggcgtgtcagacggtgattttgtttcctac
gtaaacgaatggtgcaaagatggggctgtcctcattggcggctgctgcaggacaactcca
aacaccatcaaggccataagtagatcacttaaccaacgccactcttcgctgcatttacct
gtggcatag

DBGET integrated database retrieval system