KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324713
Entry
4324713           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 4
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4324713
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4324713
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4324713
NCBI-ProteinID: XP_015621503
UniProt: Q0JIW8 Q5ZBZ6
LinkDB
Position
1:complement(32656663..32658476)
AA seq 328 aa
MGRGGDVDGAAGALRRFVREAGGCAVVDGGLATELEAHGADLHDELWSASCLVSAPHLIR
KVHLDYLDAGANIITSASYQATIQGFQARGLSRERSEALLRRSVHIAQEARAIFAEGWSK
GPYANHRSSPRRPVLVAASIGSYGAYLADGSEYTGDYGISVTKETLKSFHRRRLQVLADA
GPDLIAFETIPNKLEAQASGDPITECAAVADACARVGAVGVNCTAPRLVHGLILSIRKVT
SKPVVVYPNSGETYVAETKEWVESEGGASETDFVSCVGKWRQAGAALVGGCCRTSPATVR
AISWALRESDDAVGGDGDRDDFPAVAVL
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggtcgcgggggcgacgtggacggcgcggcgggcgcgctgcggcggttcgtgcgggaa
gcgggagggtgcgcggtggtggacggcgggctggccacggagctggaggcgcacggcgcg
gacctgcatgacgagctctggagcgccagctgcctcgtctccgcccctcacctcatccgc
aaggtgcatttggactacctcgacgccggcgccaacatcataacctcggcgtcttaccag
gcgacgatacaggggttccaggcgagaggcctgtcgcgtgagcggagcgaggcgctgctt
cgtcggagcgtccacatcgcgcaggaggcgcgcgccatcttcgccgagggctggtccaag
ggcccgtacgccaaccaccgctcctcgccgcgccggcccgtgctcgtggccgcctccatc
ggcagctacggcgcctatctcgccgacggctccgagtacaccggcgactacggcatatcg
gtgaccaaggagacgctcaagagcttccaccggaggaggctgcaggtgctcgccgacgcg
gggcccgatctcatcgcgttcgagacgatcccgaacaagctggaggcgcaggcgagcggc
gaccccatcacggagtgcgccgccgtggccgacgcctgcgcgagggtcggcgccgtcggg
gtgaactgcaccgcccccaggctggtgcacggcctgatcctctccatcaggaaggtgacg
agcaagccggtcgtcgtgtaccccaacagcggggagacctacgtggccgagaccaaagaa
tgggtggagtcggagggcggcgcgtcggagacggacttcgtgtcgtgcgtcggcaagtgg
aggcaggcgggcgccgccctcgtcgggggttgctgcaggacgagcccggccacggtgagg
gccatctcgtgggcgctgcgtgaatcggatgacgccgtgggtggtgacggcgatcgcgac
gatttccctgcagtggccgtgctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332095
Entry
4332095           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 1
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4332095
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4332095
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4332095
NCBI-ProteinID: XP_015632081
UniProt: A3AFK7 Q8H825
LinkDB
Position
3:6354826..6357807
AA seq 329 aa
MAVAVEEIVRRAGGCAVIDGGFATQLEALGADINDPLWSAACLITKPHLIKEVHMQYLEA
GADVIISSSYQATIPGFLARGMLLEEAEGLLRRSIELALEARDEFWKSTLRKSKPVYNRA
LVAASIGSYGAYLADGSEYSGSYGEDITAEKLKDFHRRRLQVLASAGPDLIAFEAIPNKM
EAQALVELLEEENIQVPSWICFSSVDGKNLCSGESFAECLQFLNASDKVTIVGVNCTPPQ
FIEGIIRELKKQTKKAIAVYPNSGEIWDGRAKRWLPAQCFGHKSFDALAKRWQEAGASLV
GGCCRTTPSTIRAVSKVLKGKTSYSATQI
NT seq 990 nt   +upstreamnt  +downstreamnt
atggccgtggcggtggaggagatcgtcaggagggccggcgggtgcgccgtgatcgacggc
ggattcgccacgcagctggaggcgctcggcgccgacatcaacgacccgctctggagcgcc
gcctgcctcatcaccaagccgcacctcatcaaggaggttcacatgcaatatcttgaagca
ggtgccgatgtcatcatttcctcatcataccaggcaactatcccaggattcttagccaga
ggaatgcttcttgaggaggcagaagggttactgcgaaggagcattgaattggcactggaa
gcacgagatgaattctggaagtcgacgctgaggaagtccaagcctgtttacaaccgtgct
ctggtcgccgcatccattgggagctatggagcttaccttgccgatggctcagagtacagt
ggatcgtatggagaagacatcacggcagagaaactgaaggacttccacaggcgccggctg
caggttcttgcgagcgctggccctgacttgatcgcgtttgaggccatcccgaacaaaatg
gaggcacaggctttagttgagcttctggaggaagagaacatccaggtcccctcctggatc
tgcttcagctcagtggacggcaagaacctgtgctcaggagagagctttgcagagtgcctc
caattcctcaacgccagcgacaaggtgaccatcgtgggtgtcaactgcacgccgcctcag
ttcatcgagggcatcatacgcgagctcaagaagcaaaccaagaaggcgatcgcggtgtac
ccgaacagcggcgagatttgggacggcagagcgaagagatggctgccggcacagtgcttt
gggcacaagagcttcgacgcgctcgcgaagaggtggcaggaggccggcgcgagcttagtc
ggcggatgctgccggacgacgccgtcgacgatccgggccgtctccaaggtcctcaagggc
aagacgtcctattcagcaactcagatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348656
Entry
4348656           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 2
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348656
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4348656
SSDB
Motif
Pfam: S-methyl_trans CoA_binding
Other DBs
NCBI-GeneID: 4348656
NCBI-ProteinID: XP_015613413
UniProt: Q7XEH2 A3C4V2
LinkDB
Position
10:14921930..14925036
AA seq 335 aa
MSQQGEYHADMMAEFLRGSGGAAVIDGGLATELEANGADLKDALWSARCLFTCPDLIRKV
HLDYLEAGASVLITGSYQATIQGFLSKGFSQEESESFLRRSVELACEARAIYLEKCSNGS
DEAKDVTKYRKRPILIAASVGSYGAYLADGSEYSGDYGNEGTLEFLKNFHLRRLQVLAEA
GPDVIVFETIPNKIETQAYVELLEECKLRIPAWFGFTSKDGVNVVSGDSLIECASIADSC
KEVAAVGINCTPPRFIHELVLSIRKVTSKPILIYPNSGESYDPIRKEWVECSGISNEDFV
SYVKKWHEAGASLIGGCCRTSPDTIRGISKALHGV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtcaacaaggggagtaccacgccgacatgatggcggagttcctgcgggggagcggc
ggcgcggccgtgattgacggcgggctggcgacggagctggaggctaacggcgccgacctc
aaggacgccctctggagcgcccggtgcctcttcacctgccccgacctcatccggaaggtt
catttggactatcttgaagctggggcaagtgttctgataacaggatcatatcaggccaca
attcagggcttcctttcaaagggattttctcaggaggaaagtgaatcattcctgaggagg
agtgttgaactagcatgtgaagcacgggctatttacctggaaaaatgttctaacggttcg
gacgaagccaaagacgtaacaaaatacaggaagcgcccaatactaattgcggcatcagtt
ggttcttatggagcatacctagcagatggctctgagtatagtggtgactacggtaatgag
ggcactttggagttcctcaaaaactttcatctgagaaggcttcaagtccttgctgaagct
ggtcctgatgttattgtttttgaaactattccaaacaaaattgagactcaggcatatgtt
gaactactagaggagtgtaaattacgtattccggcatggtttggtttcacttcaaaggat
ggagtcaatgtagtaagtggtgattccctgatagagtgtgcctctattgccgattcatgc
aaggaagttgctgcagttggtattaattgcactcccccaagatttatccatgaattagtt
ttatccatccggaaggtgacaagtaaaccaatattaatatacccaaatagtggtgagagc
tatgatcctataagaaaggaatgggtggaatgctcagggatttcaaatgaggattttgtt
tcatatgtcaaaaaatggcatgaggctggggcctcactgatagggggttgctgcagaaca
agtccagatacgataagaggaatatcgaaggctctgcatggagtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352747
Entry
4352747           CDS       T01015                                 
Name
(RefSeq) homocysteine S-methyltransferase 2
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352747
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     4352747
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-GeneID: 4352747
NCBI-ProteinID: XP_015620113
UniProt: Q2QME6 A0A8J8Y7K1
LinkDB
Position
12:25641847..25645420
AA seq 342 aa
MVGKSGVAEEGGAAAAAAVRRWVEAGGGRLVMDGGLATELEANGADLNDPLWSAKCLLSS
PHLVRKVHLDYLEAGANIIITASYQATIQGFESKGFSKEQSEDLLAKSVEIAREARDMFL
KEHSDRPIQHPILVAASIGSYGAYLADGSEYSGDYGEAGTLEFLKDFHKRRLEVLAEAGP
DLIAFETIPNKLEAQAYVELLDECNISIPAWFSFNSKDGVHIVSGDSLIECATIANGCSK
VGAVGINCTPPRFIHGLILSIRKVTDKPILIYPNSGERYDAEKKEWVESTGVSDGDFVSY
VNEWCKDGAVLIGGCCRTTPNTIKAISRSLNQRHSSLHLPVA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtggggaagagcggggtggcggaggagggcggagcggcggcggcggcggcggtgagg
aggtgggtggaggccggcggcgggaggctggtgatggacggcgggctggcgacggagctg
gaggccaacggcgccgacctgaacgacccgctctggagcgccaagtgcctcctctcctcc
ccgcacctcgtccgcaaggtccatttagactacctagaagcaggtgcaaatatcataatc
acagcgtcataccaggctacaattcaaggctttgaatccaagggattttcaaaagaacaa
agtgaagacttgctcgcaaagagtgttgagattgcacgtgaagcgcgtgacatgtttctg
aaggaacattcagatcgtcccatacaacatcctatcctggttgcagcttccattggaagt
tatggggcctatcttgctgacggctctgagtacagtggggattatggcgaagctggcacg
ttagaattcctgaaagattttcataagcgaaggctggaggttcttgcggaagcaggtcct
gatttgatcgcctttgaaacaattcccaacaaattggaagctcaggcttacgttgaactt
cttgacgaatgtaacatcagtatccctgcatggttctcatttaattcaaaagatggagtt
cacattgtgagtggagactcgttaattgaatgtgctactattgctaatgggtgttcgaag
gttggtgcagttggaataaattgcacacctccaagatttatccatggcctgatactctcc
attcgaaaggtcacagataagccaattctgatatatcccaacagcggagaaagatatgat
gctgagaaaaaggagtgggtggaatcaactggcgtgtcagacggtgattttgtttcctac
gtaaacgaatggtgcaaagatggggctgtcctcattggcggctgctgcaggacaactcca
aacaccatcaaggccataagtagatcacttaaccaacgccactcttcgctgcatttacct
gtggcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352832
Entry
4352832           CDS       T01015                                 
Name
(RefSeq) 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase 1
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352832
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4352832
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     4352832
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 TM1586_NiRdase
Other DBs
NCBI-GeneID: 4352832
NCBI-ProteinID: XP_015619819
UniProt: Q2QLY5
LinkDB
Position
12:26644928..26651154
AA seq 766 aa
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN
TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI
VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL
LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI
ETYFADIPAESYKTLTSLNSVTAYGFDLIRGAKTLDLIKSAGFPSGKYLFAGVVDGRNIW
ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV
EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSAR
LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQE
ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT
VFWSKLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI
QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS
IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKML
AVLDTNILWVNPDCGLKTRKYNEVKPALTNMVSAAKLIRTQLASAK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgtctcacattgttgggtacccccgcatgggccccaagagggagctcaagtttgcc
ctggagtctttctgggatgggaagagcagcgctgaggatttggagaaggttgcgaccgac
ctcagggccagcatctggaagcaaatggctgacgctgggatcaagtacatccccagcaac
accttctcgtactatgatcaggttcttgacacggctgccatgcttggtgctgtcccagag
cgctactcatggactggtggagagattgggttcagcacctacttctcgatggctaggggc
aatgccactgtccctgccatggagatgaccaagtggtttgacaccaactaccactttatc
gtccctgaacttggtcccaacaccaagttctcctactcttcccacaaggctgtgaatgaa
tacaaggaggctaaggcgctcggcgttgacaccgtgccagtacttgttggaccagtttca
tacttgttgctctccaaacctgccaagggtgtagagaagtcgttcgctcttctttccctt
ctgagcagcatccttcctgtctacaaggaggttattgctgagttgaaggcagctggtgct
acttggattcagtttgatgaacccacacttgttcttgaccttgactctcaccaattggct
gcattctctgctgcatacacagaacttgagtcggcactttctggattgaatgtgcttatt
gagacatacttcgctgacattcctgctgaatcatacaagaccctcacatccctgaacagc
gtgactgcttatggttttgaccttatccgtggagccaagactcttgaccttatcaagagt
gctggtttcccctctggaaagtacctctttgccggtgttgtggatggacgcaacatctgg
gctgatgatctcgctgcatctctcactacccttgagtctcttgaggctattgttggaaag
gacaagcttgtggtctcgacttcctgctcactcatgcacaccgctgtggatcttgtaaat
gagaccaagctcgatagcgagattaagtcatggctcgcttttgctgcccaaaaggtggtt
gaggtgaatgcccttgctaaggcattggctggacagaaggatgaggcttactttgcagca
aacgctgctgctcaggcctccaggaggtcatcacctcgtgtgacaaacgaggaagtccaa
aaggctgctgctgctctgaaggggtctgaccaccgccgtgctaccaatgttagcgctaga
ctggacgcacagcagaagaagctcaaccttccagtccttcctacaaccacaattggttca
ttcccacagactgtggagctcaggagagtccgccgtgagtacaaggcaaaaaagatctct
gaggaggagtacatcagtgccatcaaggaggaaatcagcaaggttgttaagatccaggaa
gagcttgacatcgatgtccttgttcacggcgagcctgagagaaacgatatggttgagtac
ttcggtgagcagctttctggttttgcattcactgccaacggatgggtgcaatcttatgga
tcacggtgtgtcaagccaccaattatctatggtgatgtgagccgccccaaccccatgact
gtgttctggtccaagttggcgcagagcatgacctctcgccccatgaagggaatgttgact
ggtcccgtcacaatccttaactggtcttttgtcaggaatgaccagccgaggtttgagaca
tgctaccagattgctcttgccatcaagaaggaggtcgaggaccttgaggctggtggtatt
caggtcatccaaatcgatgaggctgctttgagagaaggtctgccactccgcaaggcggag
catgctttctacttggactgggctgttcactccttcagaatcaccaactgcggtgttcag
gacaccacccagatccacacccacatgtgctactctaacttcaacgacatcatccactcc
atcatcaacatggacgctgatgtgatcaccatcgagaactcccggtccgacgagaagctg
ctctccgtcttccgcgagggtgtgaagtatggtgctggcattggccctggtgtctatgac
atccactccccaaggatcccgtccacagaggagattgcggaccgcgtcaacaagatgctc
gcggtgctcgacactaacattctctgggtgaaccctgactgcggtctcaagacccgcaag
tacaacgaggtcaagcccgcccttaccaacatggtttcggccgccaagctcatccgcacc
cagctcgccagcgcgaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352833
Entry
4352833           CDS       T01015                                 
Name
(RefSeq) 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase 2
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00450  Selenocompound metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352833
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4352833
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     4352833
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 TM1586_NiRdase
Other DBs
NCBI-GeneID: 4352833
NCBI-ProteinID: XP_015619851
UniProt: Q2QLY4
LinkDB
Position
12:26657183..26662934
AA seq 766 aa
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN
TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI
VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL
LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI
ETYFADIPAESYKTLTSLNSVTAYGFDLIRGSKTLDLVKSAGFPSGKYLFAGVVDGRNIW
ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV
EVNALAKALAGQKDEAYFAANTAAQASRRSSPRVTNEEVQKAAAALRGSDHRRATNVSAR
LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEDEYVSAIKEEISKVVKIQE
ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNAMT
VFWSKMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI
QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS
IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVLAAKLIRTQLASAK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgtctcacattgttggatacccccgcatgggccccaagagggagctcaagtttgcc
ctggagtctttctgggatgggaagagcagcgctgaggatttggagaaggttgcgaccgac
ctcagggccagcatctggaagcaaatggctgacgctgggatcaagtatatccccagcaac
accttctcgtactatgatcaggttcttgacacgaccgccatgcttggtgctgtcccagag
cgctactcatggaccggtggagagattgggttcagcacctacttctcgatggctagggga
aatgccactgtccctgctatggagatgaccaagtggtttgacaccaactaccactttatc
gtccctgaacttggtcccaacaccaagttctcctactcttcccacaaggctgtgaatgaa
tacaaggaggccaaggcgctcggcgttgacaccgtgccagtacttgttggaccagtttca
tacttgttgctctccaagcctgccaagggtgtagagaagtcgttcgctcttctttccctt
ctcagcagcatccttcctgtctacaaggaggttattgctgagttgaaggcagctggtgct
acatggattcagtttgatgagcccacacttgttcttgaccttgactctcaccaattggct
gcattctctgcagcgtacacagaactcgagtcggcactttctggattgaatgtgcttatt
gagacatacttcgctgacattcctgctgaatcatacaagaccctcacatccctgaacagc
gtgactgcttatggttttgaccttatccgtggttccaagactcttgaccttgtcaagagt
gctggtttcccctctggcaagtacctctttgctggtgttgtggatggacgcaacatctgg
gctgatgatctcgccgcatctctcaccaccctcgagtctcttgaggctattgttggaaag
gacaagcttgtggtctcgacttcctgctcactcatgcacaccgctgtggatcttgtaaat
gagaccaagctcgatagcgagattaagtcatggcttgcttttgctgcccaaaaagtggtt
gaggtgaatgcccttgctaaggcattggctggacagaaggatgaggcttactttgcagca
aacactgctgctcaggcctccaggaggtcatcacctcgtgtgacaaacgaggaagtccaa
aaggctgctgctgctctgagggggtctgaccaccgccgtgctaccaatgttagcgctagg
ttggacgcacagcagaagaagctcaaccttccagtccttcctacaaccacaattggttca
ttcccacagactgtggagctcaggagagtccgccgtgagtacaaggctaaaaagatctct
gaggatgagtacgtcagtgccatcaaggaggaaatcagcaaggttgttaagatccaggaa
gagcttgacattgatgtgcttgttcacggcgagcctgagagaaacgatatggttgagtac
tttggtgagcagctttctggttttgcatttactgccaatggatgggtgcaatcctatgga
tcccggtgtgtcaagccaccaattatctatggtgatgtgagccgccccaacgccatgact
gtgttctggtccaagatggcgcagagcatgacctctcgccccatgaagggaatgttgact
ggtcccgtcacaatccttaactggtcttttgtcaggaatgaccagccgaggtttgagaca
tgctaccagattgctcttgccatcaagaaggaggtcgaggaccttgaggctggtggtata
caggtcatccaaatcgatgaggctgctttgagagaaggtctgcccctccgcaaggcggag
catgctttctacttggactgggctgttcactccttcagaatcacaaactgcggtgttcag
gacaccacccagattcacacccacatgtgctactctaacttcaacgacatcatccactcc
atcataaacatggacgccgatgtgatcaccatcgagaactcccggtccgacgagaagctg
ctctctgtcttccgcgagggtgtgaagtatggtgctggcattggtcctggtgtctacgac
atccactcccccaggatcccgtccacggaggagattgcggaccgcatcaacaagatgctt
gcggtgctcgacactaacattctctgggtgaaccctgactgcggtctcaagacccgcaag
tacaccgaggtgaagcctgccctcaccaacatggttttggccgccaagctcatccgcacc
cagctcgctagcgcgaagtga

DBGET integrated database retrieval system