KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324755
Entry
4324755           CDS       T01015                                 
Name
(RefSeq) isoprenyl transferase
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4324755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4324755
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4324755
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4324755
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-GeneID: 4324755
NCBI-ProteinID: XP_015628979
UniProt: A2ZZQ4 Q94DE7
LinkDB
Position
1:complement(37033292..37036013)
AA seq 295 aa
MRQAANTMLPSHSPAATHQLPTSPRRSTRPAPPPPCPCPRAGAAPAAESLLPGCLRAESL
PRHVAVVMDGNARWARARGLPSAAGHEAGRRALEETVRLSRAWGIRALTAFAFSNENWSR
PKVEVDFLMRLFERVIHDSVAEFLREGIRLRVIGDSSRLPVSLQKIAREAEETTRNNSQL
DLTLAISYSGRRDIVQACRKLAQKVQSKALAAEDIDEALFADELETSCAADEFPYPDLLI
RTSGELRLSNFLLWQSAYSELFFTNTLWPDFGEADYLEALCSFQSRDRRFGVRKL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcgccaagccgccaacaccatgctgccctcccactctccagctgctacccatcagcta
cccacctcccctcgccgcagcacgcgccccgcgccgccaccaccatgcccatgcccgcgc
gccggcgcagccccggcggccgagtctctcctccctggatgccttcgggcggagtcgctg
ccccggcacgtggcggtggtgatggacgggaacgcgcggtgggcgcgggcgcgggggctc
ccgtcggcggccgggcacgaggccgggcggcgcgcgctggaggagacggtgcgtctctcc
cgcgcctggggcatccgcgcgctcactgccttcgccttctccaacgagaactggagccgc
cccaaggtggaggtggacttcttgatgaggctgttcgagcgggtgatccacgatagcgtc
gccgagtttctgagggaaggaattcggctacgtgtaatcggtgacagctcaaggctaccg
gtttctctacagaagattgcgagagaagccgaggagaccacgaggaacaattcacagctt
gatctgacactggcaatcagctacagcgggaggagggacatcgtgcaggcgtgccggaag
cttgcccagaaggtgcagagcaaggcgctcgcggcggaggacatcgacgaggcgctgttc
gccgacgagctcgagacgagctgcgcggccgacgagttcccgtaccccgaccttctcatc
aggaccagcggcgagctgaggctgagcaacttcttgctgtggcagtcagcgtactcggag
ctcttcttcaccaacacgctgtggcctgatttcggggaggctgattacctcgaagcgctt
tgctccttccagagcagagacaggcgatttggtgtaagaaaattgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328624
Entry
4328624           CDS       T01015                                 
Name
(RefSeq) dehydrodolichyl diphosphate syntase complex subunit NUS1 isoform X1
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4328624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4328624
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4328624
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4328624
SSDB
Other DBs
NCBI-GeneID: 4328624
NCBI-ProteinID: XP_015623689
LinkDB
Position
2:complement(5470927..5475221)
AA seq 286 aa
MLIIYVSPMQISYSPMILKLILGLLWCLVHLVISFFGSLSHLKNDLECYLISFKLLPKYR
NLHLERLAYLGVVVDSREAKNALKVKQLLRWFSTIGINYLILYDIEGVLKELIQPGIETS
TDGNPINSLDVVADTKASCYRHGGMFMECLSSSDGKEAIAKVANLLYSTCCNSDNKSEIA
FTEADMTHALKAVGTGGPEPDLLLVYGPGRFHLGFPAWRLRYTEIMYVGPLESMKYGTIV
KALYRFSRKYQNYGGISLLVIFHYSFDVFNYQLNPHKSTSSVSQCK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgttgatcatttatgtttcaccaatgcagatatcttattcacctatgattttaaagctc
atcttagggttgctgtggtgccttgtccacttggtgatcagcttctttggttcattgtca
catctgaagaatgatctagaatgctatctcatttcattcaagttgttgcccaagtaccga
aatctacatcttgagagacttgcatacttgggtgttgtagtagatagcagagaggcaaag
aatgctttgaaggtcaagcaacttttacgctggttctcaactattgggattaattatcta
attctctatgacattgaaggagtactaaaggagttgattcaacctggtatagaaacctca
acagatgggaacccaataaattctttagatgtagttgcagataccaaagcttcatgctat
agacatggagggatgtttatggagtgtctatctagctctgatggcaaggaagccatcgcc
aaagtagcaaacttactgtattccacttgctgcaactctgataacaaaagtgagattgcg
tttacagaagctgacatgactcatgcactgaaagctgtaggtactggtgggccagaacct
gatcttctccttgtgtatggtcctggtagatttcatttgggatttcctgcatggagatta
cggtacacagagattatgtacgtgggtccactggaatcaatgaaatatggtaccattgtg
aaagctttatatcggttctcacgtaaatatcaaaattatggaggcatttcactcttggtt
attttccactacagtttcgatgtatttaactatcagttaaatcctcataaaagtacttcc
tccgtttcacaatgtaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331944
Entry
4331944           CDS       T01015                                 
Name
(RefSeq) dehydrodolichyl diphosphate syntase complex subunit NUS1 isoform X1
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4331944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4331944
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4331944
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4331944
SSDB
Other DBs
NCBI-GeneID: 4331944
NCBI-ProteinID: XP_015631063
LinkDB
Position
3:complement(5085605..5090352)
AA seq 291 aa
MYDIHFVLSQEIIILWFLCRAAFVANEIPLFMNQSPPHVWMLMSRPSVIIKLILGLLWFI
VHLAISLCSLWFDLIYSIECYLISFGLIPKYRKFQLDRLKHLAVVVDSREAKNVAKINQL
LCWLSNVGVKYVCLYDIDGVLKKTFAPAMNGSRYGNSGKYLDVGANTKALTCCHKEMTIE
CISGSDGKDGIAKAASLLCSTCVNGNRNTCGNGEIVFTEADMSGALKAIGCGGPEPDLLL
VYGPARCHLGFPAWRLRYTEIMHMGPLNSMKYGAIVKAFYKFSKKYQNFGK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtatgatatccactttgtcctttctcaagaaataattatcttgtggttcttgtgcagg
gcggcatttgtggccaatgagattcccctattcatgaatcagtctcctccacatgtatgg
atgctgatgtctcgaccatcagtgattatcaagctgattctggggttgctttggttcatc
gtccacttagcaatcagcctttgcagtttatggtttgatctgatctacagtatagaatgc
tatctcatttcattcgggctgattccaaagtatcggaaattccaactggataggctcaaa
cacttggctgttgtggtagatagcagagaagctaaaaatgttgcaaagatcaatcagctc
ttatgttggctctcaaatgttggtgtgaagtatgtatgtctttatgacattgatggagtg
ctgaagaaaacatttgcacctgctatgaatggttcaagatatgggaattcaggaaaatat
ctggatgtgggtgcaaatacaaaagctttgacctgttgtcataaagagatgacaatagag
tgtatttctggttctgatggcaaggatgggattgctaaagcagccagcttactttgctca
acttgtgtgaacggcaataggaatacttgtggaaatggtgaaatagtatttacagaagct
gacatgtccggtgcattgaaagcaataggttgtggtggaccagaacctgatcttcttctt
gtgtatggccctgctagatgccatttaggttttcctgcatggagattgcggtatactgag
ataatgcatatgggaccactgaattcaatgaaatatggcgccattgtgaaagcattctat
aaattctcgaagaaataccaaaattttggtaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340251
Entry
4340251           CDS       T01015                                 
Name
(RefSeq) dehydrodolichyl diphosphate synthase 6 isoform X1
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4340251
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4340251
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4340251
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4340251
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-GeneID: 4340251
NCBI-ProteinID: XP_015641163
LinkDB
Position
6:3404937..3407720
AA seq 316 aa
MCSVCRSDTACWFLPIKMLGSLMSYSPSVDSKTENTDELIATGVLASLQNFIRKCIVAVL
SYGPMPKHIAFIMDGNRRYAKFRSIQEGSGHRVGFSALIASLLYCYEMGVKYITVYAFSI
DNFKRDPTEVKSLMELMEEKINELLENRNVINKVNCKINFWGNLDMLSKSVRVAAEKLMA
TTAENTGLVFSVCMPYNSTSEIVNAVNKVCAERRDILQREDADSVANNGVYSDISVADLD
RHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQR
VHPSIEQSRNLAKKQL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtgctcagtttgcaggtctgatactgcttgttggttcctccccatcaaaatgcttggc
tcacttatgtcttactcaccttcagtggattcaaagacggagaacactgatgagttaatt
gcgactggtgttcttgctagtctgcagaatttcatccgcaaatgcattgtagctgtcctc
tcgtatggcccaatgcctaagcatattgcatttattatggatggtaaccgtagatatgct
aaattcaggagtatccaggaaggctctggtcacagggtgggcttctctgctctcattgcc
agcctgctctactgctatgaaatgggcgtgaagtatatcacggtgtatgcatttagcatc
gataattttaagcgagatccgactgaggtgaaatccttgatggagttaatggaggaaaag
atcaatgaactgctagaaaacagaaatgtcatcaacaaggttaactgtaagatcaacttc
tgggggaacttggacatgttgagcaaatcagtgagggtagcagctgagaaactgatggct
accactgctgaaaacacgggactggtcttctctgtttgcatgccatacaactccacttct
gagattgtcaatgcggtcaataaggtctgtgcagaaaggagggatatactgcagagggag
gatgctgacagtgttgcgaataatggtgtgtattcagacatttcagtggcagatctggac
cgccatatgtacagcgctggttgccccgatcctgacattgtgatccggacctcaggtgag
actcgcctgagcaatttccttctgtggcagacgacgttcagtcatttgcagaatccagac
cctctttggccggagttctctttcaagcaccttgtctgggccatactccagtaccaaaga
gttcacccttctattgagcaaagcagaaatctggctaagaagcagctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343863
Entry
4343863           CDS       T01015                                 
Name
(RefSeq) dehydrodolichyl diphosphate synthase 6 isoform X1
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4343863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4343863
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     4343863
Prenyltransferases [BR:osa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   4343863
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-GeneID: 4343863
NCBI-ProteinID: XP_015648015
UniProt: A3BM14
LinkDB
Position
7:24973540..24976584
AA seq 335 aa
MANACSFFLIRASKSENFMSFPVCRPDTACWSLPIKMLGSLISYSPSVNPKTENPDELIA
TGVLASLQNFIRKCIVAVLSYGPMPKHIAFIMDGNRRYAKFRSIQEGSGHRMGFSALIAS
LLYCYEMGVKYITVYAFSIDNFKRDLTEVKSLMELMEEKINELLENRNVINKVNCKINFW
GKLDMLSEPVRVAAEKLMVSTAENKGLVFSVCMPYNSTSEIVIAVNKVCAERRDILQRED
VDSVANNGVHSDISVADLDHHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDP
LWPEFSFKHLVWAILQYQRVHPYIEQSRNLAKKQL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcaaacgcttgctcctttttcttgatcagagcaagcaagtctgaaaattttatgtct
tttccagtttgcaggcctgatactgcctgttggtccctccccatcaaaatgcttggttca
cttatctcttactcaccttcagtgaatccaaagacggagaaccctgatgagttaattgcg
actggtgtccttgcgagtctgcaaaactttatccgcaaatgcatcgtagctgtcctctca
tatggcccaatgcctaaacatattgcatttattatggacggtaaccgtagatatgctaaa
ttcaggagtatccaggaaggctctggtcacaggatgggcttctctgctctcattgccagc
ctactctactgctatgaaatgggcgtgaagtatatcacagtgtatgcatttagcatcgat
aattttaagcgagatctgactgaggtgaaatccttgatggagttaatggaggaaaagatc
aatgaactgctagaaaacagaaatgtcatcaacaaggttaactgtaagatcaacttctgg
gggaagttggacatgttgagcgaaccggtgagggtagcagctgagaaactgatggttagc
actgctgaaaacaagggactggtcttctctgtttgcatgccatacaactccacttctgag
attgtcattgcggtcaataaggtctgtgcagaaaggagggatatactgcagagggaggat
gttgacagtgttgcgaataatggtgtgcattcagatatttcagtggcagatctggaccac
catatgtacagcgctggttgccccgatcctgatattgtgatccggacctcaggcgagact
cgcctgagcaatttccttctgtggcagacgacgttcagtcatttgcagaatccagaccct
ctttggccggagttctctttcaagcaccttgtctgggccatactacagtaccaaagagtt
cacccttatattgagcaaagcagaaatctggctaagaagcagctgtaa

DBGET integrated database retrieval system