KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324760
Entry
4324760           CDS       T01015                                 
Name
(RefSeq) protein BUD31 homolog 1
  KO
K12873  bud site selection protein 31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4324760
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4324760
 Complex C
    4324760
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 4324760
NCBI-ProteinID: XP_015611690
UniProt: Q94DE2
LinkDB
Position
1:complement(37069411..37071918)
AA seq 145 aa
MPKIKTSRVKYPGGWELIEPTIRELDAKMREAENDTHDGKRKCEALWPIFRISHQRSRYI
YDLYYRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEKVIECVHCGCRGCASGD
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcctaaaataaagacaagccgtgtcaaatatcctggaggatgggagcttattgaacca
actatccgtgagttggatgccaaaatgagggaagctgaaaatgacacacatgatgggaag
agaaagtgcgaagccctctggccaattttccgtatttcccatcaaagaagtcgctacata
tatgatctttattacagaaggaaggagatatcaaaagagttgtatgagttttgcctggac
cagggttatgcagaccgtaatctgattgcaaagtggaaaaagccgggttatgagcgcctt
tgctgtcttcgatgcatacagacacgagaccacaactttgcaactacatgcgtctgccgg
gtccccaagcatctcagagaggagaaggttatagaatgtgttcactgtggatgcagaggc
tgtgccagcggtgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337198
Entry
4337198           CDS       T01015                                 
Name
(RefSeq) protein BUD31 homolog 1
  KO
K12873  bud site selection protein 31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4337198
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4337198
 Complex C
    4337198
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 4337198
NCBI-ProteinID: XP_015636910
UniProt: Q94DE2
LinkDB
Position
4:complement(32868115..32871642)
AA seq 145 aa
MPKIKTSRVKYPGGWELIEPTIRELDAKMREAENDTHDGKRKCEALWPIFRISHQRSRYI
YDLYYRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEKVIECVHCGCRGCASGD
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcctaaaataaagacaagccgtgtcaaatatcctggaggatgggagcttattgaacca
actatccgtgagttggatgccaaaatgagggaagctgaaaatgacacgcatgatgggaag
agaaagtgcgaagccctctggccaattttccgtatttcccatcaaagaagtcgctacata
tatgatctttattacagaaggaaggagatatcaaaagagttgtatgagttttgcctggac
cagggttatgcagaccgtaatctgattgcaaagtggaaaaagccaggctatgagcgcctt
tgctgtcttcgatgcatacagacacgagaccacaactttgcaactacatgtgtctgccgg
gtccccaagcatctcagagaggagaaggttatagaatgtgttcactgtggatgcagaggc
tgtgccagcggtgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338942
Entry
4338942           CDS       T01015                                 
Name
(RefSeq) protein BUD31 homolog 2
  KO
K12873  bud site selection protein 31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338942
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4338942
 Complex C
    4338942
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 4338942
NCBI-ProteinID: XP_015637596
UniProt: Q65WT0
LinkDB
Position
5:21875917..21878453
AA seq 145 aa
MPKIKTSRVKYPEGWELIEPTLRDLEAKMREAENDPHDGKRKCEALWPIFRISHQKSRYI
YDLYYRRKEISKELYEFCLDQGHADKNLIAKWKKPGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEKVIECVHCGCRGCASGD
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcctaagataaagacaagccgtgtcaagtatcctgaaggatgggagcttatagaacca
actctgcgtgatttggaagccaagatgagggaagccgagaatgatccacatgatgggaag
aggaagtgcgaagctctctggccaatctttcgtatttctcatcaaaaaagccgttacata
tatgatctttactatcgaagaaaggagatatcaaaagagctgtatgaattttgtttggac
caaggtcatgctgataaaaatctgatcgcgaagtggaaaaagccaggttatgagcgtctt
tgctgcctccgatgcatacagacacgagaccacaactttgcaaccacttgtgtctgtagg
gtccccaagcacctcagggaagaaaaggttatagagtgtgtccattgtgggtgcagaggg
tgtgccagtggtgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351510
Entry
4351510           CDS       T01015                                 
Name
(RefSeq) protein BUD31 homolog 3
  KO
K12873  bud site selection protein 31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4351510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4351510
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4351510
 Complex C
    4351510
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 4351510
NCBI-ProteinID: XP_015620231
UniProt: P35682
LinkDB
Position
12:2449113..2451532
AA seq 145 aa
MPKIKTSGVKYPDGWELIEPTLSELHSKMREAENDPHDGRRKCEALWPIFKINHQRSRYL
YDLYYNRKEISQELYEFCLDQGHADRNLIAKWKKQGYERLCCLRCIQTRDHNFATTCVCR
VPKHLREEQVIECVHCGCKGCASGD
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcctaagataaaaacaagtggtgtgaaatatcccgatgggtgggagcttatagaaccc
accctctcagagctccattccaagatgagagaagctgagaatgatccgcatgatgggaga
aggaagtgcgaggcactgtggcccatcttcaagatcaatcaccagaggagccgatatctt
tatgacctatactacaacaggaaggagatatcccaggagttgtatgagttctgccttgac
cagggacatgctgaccgtaacctcatcgccaaatggaagaagcaaggctatgagcgtctc
tgctgcctgcgctgtatccagacacgagaccacaactttgcgaccacctgtgtttgcagg
gttcctaagcacctaagggaagaacaggtgatagagtgtgtccactgtggttgcaaaggt
tgtgctagtggtgactaa

DBGET integrated database retrieval system