KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324764
Entry
4324764           CDS       T01015                                 
Name
(RefSeq) amidophosphoribosyltransferase, chloroplastic
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4324764
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4324764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4324764
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     4324764
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4324764
SSDB
Motif
Pfam: GATase_7 GATase_6 Pribosyltran GATase_4 GATase_2
Other DBs
NCBI-GeneID: 4324764
NCBI-ProteinID: XP_015622077
UniProt: Q8RUM9
LinkDB
Position
1:complement(37866101..37868060)
AA seq 624 aa
MNWEIRGPKIPFRITRTVYYTVQYTLRTYKKKFSKKYDRHTPTWASLNLVPSLTFGRASS
EALTLPKLPRTPPMAAAAAAATATASSGLIRCATGGAPAHGHHQVFRCSAAKPSPLALRH
RAGRPAPLQAFPEYDRVTPFDYDGEVDGGDGDDHPREECGVFGVVGDPDATSLCYLGLQK
LQHRGEEGAGIAAAGDDGTIKLERGLGLVGDVFGDPARLGKLPGQAAIGHVRYSTAGAAA
SLRNVQPFLAGYRFGQLAVAHNGNLVNYQALRNKLEAQGSIFSTSSDTEVILHLIATSLS
RPLLARICDACERLAGAYSLLFLTADKLLAVRDPFGFRPLVMGRRANGAIVFASETCALD
LIDATYEREVEPGEVVVVDRRDMSVSSACLVPHRPRKSCVFEHIYFALPNSVVFGHAVHE
RRNAYGRALAEESPAPTADVVIPVPDSGFYAALGFSQTSGLEFQQGLIRWHYSGRSFIQP
SQAIRDLAVKLKLAPVHGVIRGKSVVVVDDSLVRGTTSSKIVRLLRDAGAREVHMRIASP
PVIGSCLYGIDTPSEGELISNRMDLEGVRRAIGCDSLAFLSLDKLHTIYGDEAHELCDAC
FSRNYPVLPTVPEPVPELVSAFED
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgaactgggaaatacgaggcccaaagataccattccggataacacggaccgtatattat
acggtacaatacacactgcgtacgtataaaaaaaaatttagtaagaaatacgatcgccac
acgcccacctgggcctccttaaatctcgtcccttcacttacgttcgggagggcatcctcg
gaagccctcaccctcccaaaactcccacgcacaccaccaatggccgccgccgccgccgcc
gccaccgccaccgcctcctccggcctcatccgctgcgccacgggaggcgcgccggcgcac
ggccaccaccaggtgttcaggtgctccgccgccaagccgtcccctctcgcgctgcgccac
cgcgcgggccgccccgcgccgctgcaggccttccccgaatacgaccgcgtcacgcctttc
gactatgacggtgaggtggacggcggcgacggcgacgaccacccgcgcgaggagtgcggc
gtgttcggcgtcgtcggggacccggacgccacgtcgctctgctacctcggcctgcagaag
ctgcagcaccgcggggaggagggggctggcatcgccgccgcgggggacgacggcacgatc
aagctggagagggggctggggctcgtcggggacgtgttcggcgacccggcccgcctcggc
aagctccccggccaggccgccatcggccacgtgaggtactccaccgccggcgccgccgcc
tccctgcgcaacgtgcagccgttcctcgccgggtacaggttcgggcagctcgccgtggcg
cacaacggcaacctggtgaactaccaggcgctgcggaacaagctggaggcgcagggctcc
atctttagcacgtcgtcggacacggaggtgatcctgcacctcatcgccacctcgctctcg
cgccctctgctcgcgcgcatctgcgacgcctgcgagcgcctcgccggggcctactcgctg
ctgttcctgacggcggacaagctcctggccgtgcgcgacccgttcggcttcaggcccctg
gtgatgggccgccgcgccaacggcgccatcgtgttcgcgtcggagacctgcgcgctcgac
ctcatcgacgccacgtacgagcgcgaggtggagccaggggaggtcgtcgtcgtcgaccgc
cgcgacatgtcggtgtcctccgcctgcctcgtcccgcaccgcccccgcaagtcgtgcgtc
ttcgagcacatctacttcgcgctcccaaactccgtggtgttcggccacgccgtccacgag
cgccgcaacgcctacggccgcgcgctcgccgaggagtcccccgcccccaccgccgacgtc
gtcatccccgttccggactcggggttctacgccgcgctgggattctcgcagacgtcgggg
ctcgagttccagcaaggcctcatccggtggcactacagcggccgcagcttcatccagccg
tcgcaggcgatccgcgacctcgccgtcaagctcaagctcgcgcccgtgcacggcgtcatc
aggggcaagagcgtggtggtggtcgacgactcgctcgtccgcggcaccacctcgagcaag
atcgtgcgcctgctccgcgacgccggcgcgcgcgaggtgcacatgcggatcgccagcccg
ccggtcatcggctcctgcctctacggcatcgacacgcccagcgagggcgagctgatatca
aacaggatggacctcgagggagtccgcagggcgatcggctgcgactccctcgcgttcctc
tcgctcgacaagctccacaccatctatggcgacgaggcgcatgagctctgcgacgcctgc
ttctcgcggaattacccggtgctccccaccgtgccggagccggtgccggagttggtgtcc
gccttcgaagactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338879
Entry
4338879           CDS       T01015                                 
Name
(RefSeq) amidophosphoribosyltransferase, chloroplastic
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4338879
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4338879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4338879
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     4338879
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4338879
SSDB
Motif
Pfam: GATase_7 GATase_6 Pribosyltran GATase_4 GATase_2
Other DBs
NCBI-GeneID: 4338879
NCBI-ProteinID: XP_015640464
UniProt: Q6I5V5 Q0DHY3
LinkDB
Position
5:21141362..21143455
AA seq 541 aa
MAAAAAAASTSRLLLLRHHHHAAADGSKQQQQLRYSSKPSSLALPRLRLLPAAGALLPDR
VTPFSYEEDDESDDHPREECGLVGVVGDPDASSLCYLGLQKLQHRGEEGAGIVAVGGDGK
LKSVTGLGLVADVFGDPARLASLPGPAAIGHVRYSTAGAAASLRNVQPFLAGYRFGQVAV
AHNGNLVNYQALRNKLEARGSIFNTSSDTEVILHLIATSLSRPLLSRICDACERLAGAYS
LLFLTADKMFAVRDPHGFRPLVLGRRRNGTVAFASETCALDLIEATYEREVEPGEVVVVD
RRDMSVSSACLVPHRPRRSCVFEHIYFALPNSVVFSHAVHERRTAFGRALAEESPAAGAD
VVIPVPDSGFYAALGFARASGLEFQQGLIRWHYSGRSFIQPTQAIRDLAVKLKLAPVHGV
IRGKSVVVVDDSLVRGTTSSKIVRLLRDAGAREVHMRIASPPVVGSCLYGIDTPSEGELI
SNRMDLEGVRREIGSDSLAFLSLGKLHSIYGAEAEGYCDACFSRNYPVLPTLPEPVVELE
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccgcgtcaacgtcgcgcctcctcctcctccgccaccaccac
cacgccgccgccgacgggtcgaagcagcagcagcagctcaggtattcctccaagccgtct
tctctcgctctgccccggctgcgccttttgccggcggccggggcgctgctgcccgaccgg
gtcaccccgttctcctacgaggaggacgacgagtccgacgaccacccgcgcgaggagtgc
gggctggtcggggtcgtgggggaccccgacgcgtcgtcgctctgctacctcgggctgcag
aagctgcagcaccgcggggaggagggtgccgggattgtcgccgtcgggggtgacgggaag
ctcaagtcggtcaccgggctcggcctcgtcgccgacgtgttcggtgaccccgcacggctg
gcatcgctccccgggccagccgccatcgggcacgtgaggtactccaccgccggcgccgcc
gcgtcgctgcggaacgtgcagccgttcctggccgggtacaggttcgggcaggtcgccgtc
gcgcacaacggcaacctcgtcaactaccaggcgctgcggaacaagctggaggcgaggggc
tccatcttcaacacctcgtcggacacggaggtcatcctccacctcatcgcgacgtcgctg
tcgcggccactgctgtcccgcatctgcgacgcgtgcgagcgcctcgcgggggcctactcg
ctgctgttcctgacggccgataagatgttcgccgtgcgcgacccgcacgggttccgcccg
ctggtgctcggccgccgccgcaacggcaccgtcgcgttcgcgtcggagacttgcgcgctg
gacctcatcgaggcgacctacgagcgcgaggtggagcccggggaggtggtcgtcgtcgac
cgccgcgacatgtccgtctcctcagcgtgcctcgtcccgcaccgcccccgccgctcctgc
gtcttcgagcacatctacttcgccctcccaaactccgtcgtcttctcgcacgccgtccac
gagcgccgcaccgccttcggccgcgcgctcgcggaggagtcccccgccgcgggcgccgac
gtggtcatcccggttcccgactcggggttctacgccgcgctcgggttcgcgcgcgcgtcg
gggctggagttccagcagggcctcatccggtggcactacagcggccgcagcttcatccag
ccgacgcaggcgatccgcgacctcgccgtgaagctcaagctggcaccggtccacggcgtg
atccgcgggaagagcgtggtggtggtggacgactccctggtgcgcggcaccacctcgagc
aagatcgtgcggctgctccgcgacgccggcgcgcgcgaggtgcacatgcggatcgcgagc
ccgccggtggtgggctcgtgcctgtacggcatcgacacgcccagcgagggggagctcatc
tccaaccggatggatctcgagggcgtccgccgcgagatcggcagcgactcgctcgccttc
ctctcgctcggcaagctccacagcatctacggcgccgaggcggagggctactgcgacgcc
tgcttctcgcgcaactaccccgtgctgcccacgctgcccgagccggtcgtagagctcgag
gagtga

DBGET integrated database retrieval system