KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324773
Entry
4324773           CDS       T01015                                 
Name
(RefSeq) serine hydroxymethyltransferase 7
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4324773
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4324773
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4324773
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4324773
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     4324773
SSDB
Motif
Pfam: SHMT Beta_elim_lyase
Other DBs
NCBI-GeneID: 4324773
NCBI-ProteinID: XP_015621739
UniProt: Q8RYY6 Q7F4I8
LinkDB
Position
1:37962547..37966808
AA seq 600 aa
MDLSRPESSDLSLGFHSLGHARGHAVTGPLRLFDDMEDAKPEKSVGGGGGGGGGGGEEED
GEEGGDQHFSLLGHALCVKRPRRALYGGGGGGGAGGGGGGGGEASSCSSSSSSLHPAKRQ
ATAERGADLEARRGAVRAWGNQALAEADPDVHALMELERDRQVRGIELIASENFVCRAVL
EALGSHLTNKYSEGHPGARYYGGNQHIDGIERLCHERALAAFGLDPACWGVNVQPYSCTS
ANLAVYTGLLLPKDRIMGLEPPSGGHVSHGYYTPSGKKVSGASIFFESLSYKVNPQTGYI
DYDKLEERAMDFHPKILICGGSSYPREWDFARMRLIADKCGAVLMCDMAHISGLVAAKEC
RSPFDYCDVVTSTTHKNLRGPRGGIIFFRRGKNLRRRTGSFSQADENDYDFEDRINFAVF
PSMQGGPHNNHIAALAITLKQVATPEYKAYIIQVKKNAQALASALLRRKCRLVTGGTDNH
LVLWDLRNLGLTGKNFEKVCEACHISINKMPIYGDNGSISPGGVRIGTPAMTTRGCLEDD
FEVIADFLIRATQIASNLMKEHGKMQKEFLRGLQNNKDIIELRNQVENFASQFAMPGFDV
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggatctctcgcggccggaatcgtcggacctgtcgctgggtttccactcgctcggccac
gcccgcgggcacgcggtcacggggccgctgcggctgttcgatgacatggaggacgccaag
ccggagaagagcgtcggtggcggcggaggaggagggggaggaggaggcgaggaggaggat
ggggaggaagggggcgaccagcacttctccctcctcggccacgcgctctgcgtcaagcgt
ccacgccgcgcgctctacggaggcggaggcggaggcggggcaggaggtggaggaggagga
ggaggggaggcgtcctcctgctcgtcttcctcctcgtcgctgcacccggcgaagcggcag
gcgacggcggagcgcggcgcggatctggaggcccgccgcggcgccgtccgcgcgtggggc
aaccaggcgctggcggaggccgacccggacgtgcacgcgctgatggagctcgagcgcgac
cgccaggtgcgcgggatcgagctgatcgcgtcggagaacttcgtctgccgcgcggtgctc
gaggcgctcggcagccacctcaccaacaagtactctgagggccatcccggggctcggtac
tatggcgggaaccagcacatcgacggcatcgagcgcctctgccatgagcgcgccctcgcc
gccttcggtctcgaccccgcctgctggggggtcaacgtccagccatactcctgcacctct
gcaaacctagctgtttacacaggtctcctcctgcccaaggaccgtatcatggggctcgag
ccgccttccggtggccatgtcagccacgggtactacacaccaagtggtaagaaggtgtct
ggagcatccatattcttcgagagcttgtcgtacaaggtgaatccgcagactgggtatatt
gattacgacaagcttgaggagcgggcaatggatttccaccctaagattctcatatgtggt
gggagctcataccccagggagtgggattttgcacggatgaggctcattgctgataagtgc
ggtgcggtgctcatgtgcgatatggcacatatcagcgggcttgttgcggccaaggaatgc
cgtagtccctttgattactgtgatgtggttacatcaactactcacaagaatctgagaggt
cctagaggtggtataatatttttcaggagagggaaaaacttaaggaggcgtactggatct
ttttctcaagcggatgagaatgattatgacttcgaggacaggataaattttgcagttttc
ccttcaatgcaaggaggaccccataataatcatattgcagccttggcgataactctgaag
caagtagcaacacctgaatacaaagcatacatcatacaagttaagaaaaatgcccaagct
ttggcatcagccttactcagaagaaaatgcagattggttactggtggcaccgataaccac
ttggtactttgggacctcagaaatttaggcttgactggaaagaactttgagaaggtctgt
gaggcatgccacatctccataaataagatgccgatatatggggataatggctcaatatct
cctgggggtgttcggattggaacacctgcaatgactactagaggttgcttggaagatgac
tttgaggtgatcgcagatttcctcatcagagccacccaaatagctagtaatcttatgaaa
gaacatggaaaaatgcagaaggaattcctgagaggcctacagaacaataaagatatcata
gaactccgtaaccaggttgagaattttgcatcgcagtttgcaatgccaggttttgatgta
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334048
Entry
4334048           CDS       T01015                                 
Name
(RefSeq) serine hydroxymethyltransferase, mitochondrial
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334048
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334048
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4334048
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4334048
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     4334048
SSDB
Motif
Pfam: SHMT
Other DBs
NCBI-GeneID: 4334048
NCBI-ProteinID: XP_015629811
UniProt: Q10D68 Q0DNR3
LinkDB
Position
3:30299556..30304239
AA seq 513 aa
MAMATALRKLSSDALRRQPLSRITPLYYMASLPATEERSGVTWPKQLNAPLEEVDPEIAD
IIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESL
CQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQT
DTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSAVLFRPKLIVAGASAYARLYDYDRMR
KVCDKQKAILLADMAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKG
VNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVMSNCA
KFAQSLTAKGYELVSGGTDNHLVLVNLKSKGIDGSRVEKVLENVHIAANKNTVPGDVSAM
VPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNLALKVKAAAGGTKLKDFVATLQSDSN
IQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccatggcgacggcgctccgcaagctctcctccgacgccctccgccgccagccgctc
tcccgcatcaccccgctctactacatggcgtccctgccggcgacggaggagagatccgga
gtcacctggccgaagcagctgaacgcgccgctggaggaggtggatcccgagatcgccgac
atcatcgagcacgagaaggcccgccaatggaagggtctggagctcatcccgtcggagaac
ttcacctcggtgtcagtgatgcaggcggtgggatccgtcatgaccaacaagtacagcgag
gggtaccccggcgcgagatactacggtggaaacgaatacattgatatggccgagtcattg
tgccagaaacgtgctttggaggccttccgcttggacccagcgaaatggggagtgaatgtg
caacctctatcagggtcacctgccaacttccatgtttacactgccctattgaaaccacat
gagagaatcatggctttggatcttcctcatggtggacatctttctcacggctaccagact
gatactaagaagatttcagcagtttcgatattctttgagacaatgccctacagattggat
gaaagcactggcttgattgattatgatcagatggagaaaagtgccgttctttttaggcca
aagttgatcgttgcgggtgcaagtgcatatgcgcgtctttatgactatgaccgcatgcgg
aaggtttgtgacaagcagaaggcaatacttctagcagatatggcacatatcagtgggctt
gtcgcagctggtgttgttccatctccttttgattatgcagatgtagtgactaccactact
cacaagtcactccgtggaccacgtggagccatgatcttttacaggaagggggtgaaagga
gtaaacaagcaaggcaaagaggttatgtatgactttgaggacaagatcaatgctgctgtc
ttcccaggtctgcaaggtggaccacataatcataccattactggcttagctgttgcgctt
aagcaggcaactactccggagtacagagcttatcaagagcaagttatgagtaactgtgca
aaatttgcacagagcttgacagcaaaaggctacgaacttgtctctggtgggactgacaac
catttagtgttggtaaatctcaagagcaagggcatagatggttcaagagtggagaaggtt
ttagaaaacgtgcacattgcagcaaacaagaacacagttcctggtgatgtttcagctatg
gtaccaggaggcatcaggatgggaaccccagcactgacctcaagaggatttgttgaggag
gactttgctaaggttgctgatttcttcgatgcagcagtgaacttggctttgaaggttaag
gctgcagcaggtggaacaaaactgaaggactttgttgccactttgcaatctgatagcaac
attcaatccgagattgcaaaacttcgccatgatgtggaggaatatgcaaaacagttcccc
acaattgggtttgagaaagaaaccatgaagtacaagaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338868
Entry
4338868           CDS       T01015                                 
Name
(RefSeq) serine hydroxymethyltransferase 7
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4338868
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4338868
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4338868
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4338868
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     4338868
SSDB
Motif
Pfam: SHMT Beta_elim_lyase Aminotran_5
Other DBs
NCBI-GeneID: 4338868
NCBI-ProteinID: XP_015639962
UniProt: Q75HP7 Q5TKJ3
LinkDB
Position
5:complement(21048355..21054792)
AA seq 587 aa
MLDRATGGRRRAAGEGMDHRPDLSLALHPPPPPEGSSAAAAEEVGEEEAEGGEGRFSLMG
QPLFLKRPRPRPPRPPRARGVGDDVDVDVDDDSSPCCSSSCLSPAAKRRAAAGGLEARRA
AVRAWGCQPLTEADPDVHELMERERRRQAGGVELIASENYACRAVLDALGSHLTNKYSEG
LPGARYYCGNQHIDAIERLCCDRALAAFGLDPSRWGVNVQPYSCTSANFAVYTGLLLPND
RIMGLDSPSGGHVSHGYYTPSGKKVSGASIFFENLSYRVNPHTGYIDYDKVEEKAVDFHP
KILICGASSYPRDWDYARMRLVADKCGAVLMCDMAQISGLVAAKECRNPFDYCDIVTSTT
HKSLRGPRGGIIFFRKGKNLRKRVGSLTQVVENDQYDFEDRINFAVFPSMQGGPHNNHIA
ALAIALKQVAMPEFKAYIQQVKKNAQALAMALLRRKCRLVTGGTDNHLMLWDLRTFGLTG
KNFEKVCEACHISLNKTPIYGDNGSISPGGVRIGTPAMTTRGCLESDFEIMAEFLLRAAH
IASIVLKEHGRLQKDFLKGLENNNDIIELRNQVETFALQFAMPGFDV
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgctcgatcgcgcgacgggggggcggcgccgcgccgcgggcgaagggatggaccatcgg
cccgacctgtccctcgccctccacccgccgccgccgcccgagggctcgtccgccgccgcc
gccgaggaggtgggggaggaggaggccgaaggcggcgaggggcggttctccctcatgggc
cagccgctcttcctcaagcggccgcggccgcggcccccgcgcccgccccgcgcgcgcggg
gtgggggacgacgtcgacgtcgacgtcgacgacgactcatccccgtgctgctcctcctcc
tgcctctcgcccgcggcgaagcggcgggcggcggcgggaggactcgaggcgcgccgcgcg
gccgtgcgcgcgtggggatgccagccgctcacggaggcggacccggacgtgcacgagctg
atggagcgggagcggcgccggcaggcgggcggggtcgagctcatcgcctccgagaactac
gcctgccgcgcggtgctcgacgcgctcggcagccacctcaccaacaagtactccgagggc
ctccccggcgcgcgctactactgcggcaaccagcacatcgacgccatcgagcgcctctgc
tgcgaccgcgcgctcgccgccttcggcctcgacccgtcgcgctggggcgtcaacgtgcag
ccctactcctgcacctccgccaacttcgccgtctacacggggctcctcctccccaacgac
aggatcatgggcctcgactcgccgtccggcggccacgtcagccacgggtactacacgccc
agcggcaagaaggtctccggcgcctccatcttcttcgagaacctctcctacagggtgaac
ccgcacaccgggtacatcgattacgataaggtagaggagaaggccgtggatttccacccc
aagattctcatctgcggcgcgagctcgtatccaagggattgggactatgcacggatgcgg
cttgttgctgataagtgcggcgcagtactcatgtgtgacatggcacaaatcagtggtctt
gtggcagcgaaggaatgtcgaaatccctttgactactgcgatattgttacttcaaccaca
cacaagagcttgaggggtcctagaggtggtataatatttttcaggaaagggaaaaatcta
aggaaacgggtcggatctttaactcaagtggttgaaaatgatcagtatgattttgaggac
cgtataaattttgctgttttcccttcaatgcaaggtggaccccacaataaccatattgct
gctctggctatagctctaaaacaagtagccatgccagaattcaaagcatacattcaacaa
gtcaagaaaaatgcccaagctttggcgatggccttgctcaggaggaaatgcagactggtt
actggtggcacagataatcatttgatgctctgggacctaagaacatttggcttgacaggg
aagaactttgagaaggtctgtgaggcatgtcatatctctcttaataaaacaccaatatat
ggagataatggttcgatttctcctggaggtgtgcggattggaactcctgccatgacaact
agaggttgcttggagagtgactttgagataatggcagaattccttttgagggcagcacat
atagcaagtattgttttgaaggagcatggaaggcttcagaaggattttctgaaaggtctg
gagaacaataatgacattattgaactccggaatcaggtggagacatttgccttacaattt
gccatgccgggatttgatgtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350456
Entry
4350456           CDS       T01015                                 
Name
(RefSeq) serine hydroxymethyltransferase 4
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4350456
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4350456
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4350456
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4350456
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     4350456
SSDB
Motif
Pfam: SHMT Beta_elim_lyase Aminotran_1_2 Dak1 BRCA2
Other DBs
NCBI-GeneID: 4350456
NCBI-ProteinID: XP_015617125
UniProt: A0A0P0Y248
LinkDB
Position
11:15436714..15439957
AA seq 471 aa
MDSVASWGLTPLAAADPLVHDLLEREKRRQRSGIELIASENFTSFAVMEALGSALTNKYS
EGMPGARYYGGNDVIDEIENLCRDRALAAFRLDAASWGVNVQPYSGSPANFAAYTALLNP
HDRIMGLDLPSGGHLTHGYYTAGGKKISATSIYFESLPYKVSAATGYIDYEKLEEKALDF
RPKLIICGGSAYPRDWDYAKLRAVADKVGALLLCDMAHISGLVAAQEAANPFEYCDVVTT
TTHKSLRGPRAGMIFYRKGPKPPKKGQPEGAVYDYEDKINFAVFPSLQGGPHNHQIAALA
VALQQTMTPGFKAYAKQVKANAVAIGKYLMSKGYKMVTDGTENHLVLWDLRPLGLTGNKV
EKMCDLCSITLNKNAVFGDSSALAPGGVRIGTPAMTSRGLVEKDFEQIGEFLHQAVTICL
NIQKEHGKLLKDFSKGLVNNKDIENLKLEVEKFATSFDMPGFTLDSMKYKE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggactccgtcgcgtcgtgggggctgaccccgctcgccgcggccgacccgctcgtccac
gacctcctcgagcgggagaagcggcggcagcggagcggcatcgagctcatcgcctcggag
aacttcacctccttcgccgtcatggaggccctcggctccgcgctcaccaacaagtactcc
gaggggatgcccggggcgcgctactacggcgggaacgacgtcatcgacgagatcgagaac
ctgtgccgcgaccgcgccctcgccgcgttccgcctcgacgccgcgtcgtggggcgtcaac
gtgcagccctactccggctcgccggccaacttcgccgcctacacggcgctcctcaacccg
cacgaccgcatcatggggctcgacctcccctccggtggccacctcacccatggctactac
accgcgggcgggaagaagatctccgcgacgtcgatctacttcgagagcctcccctacaag
gtgagcgccgccacggggtacatcgactacgagaagctggaggagaaggcgctcgacttc
cgccccaagctcatcatctgcggcggcagcgcgtacccgagggactgggactacgccaag
ctcagggccgtcgccgacaaggtcggggcgctgctcctctgcgacatggcgcacatcagc
ggcctcgtcgccgcgcaggaagctgcaaatccttttgagtactgtgatgtggttaccacc
accacgcacaagtccctccgaggaccaagagctggcatgatcttctacaggaagggccct
aagcctcccaagaagggccagcctgagggtgctgtctatgactacgaggacaagatcaac
ttcgcagtgttcccgtcactgcaaggtggtcctcacaaccaccagattgcagcccttgct
gttgctctgcagcaaaccatgacacctggattcaaggcctacgcaaagcaggtcaaggcc
aacgctgtcgccattggcaagtatcttatgagcaagggctacaaaatggtgactgatgga
actgagaaccaccttgttctctgggatcttcgccctcttggcttgactggcaacaaggtt
gagaagatgtgtgacctttgcagcattacacttaacaagaatgctgtctttggtgacagc
agtgcattggctcctggcggtgtccgcattggtactcctgcgatgacatccaggggtctt
gtcgagaaggactttgagcagatcggcgagttcctccaccaggccgtgaccatctgcctc
aacatccagaaggagcacggcaagctcctcaaggacttctccaagggcctggtgaacaac
aaggacatcgagaacctcaagctggaggtcgagaagttcgccacctccttcgacatgccc
ggcttcaccctcgacagcatgaagtacaaggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352058
Entry
4352058           CDS       T01015                                 
Name
(RefSeq) serine hydroxymethyltransferase 4
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4352058
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4352058
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4352058
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4352058
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     4352058
SSDB
Motif
Pfam: SHMT BRCA2
Other DBs
NCBI-GeneID: 4352058
NCBI-ProteinID: XP_015620540
UniProt: Q2QT32
LinkDB
Position
12:complement(12392758..12396644)
AA seq 531 aa
MAMASHHLAQPPTRAALSSRPTYPLSSHHHSSRLQLPLVSGARRSRLSPAVATSPVAAPA
MDAVADWGLTTLEEADPEVYDLVEREKRRQRAGVELIASENFTSLAVMEALGSPLTNKYS
EGMPGSRYYGGNEVIDEVEELCRARALAAFHLDPEAWGVNVQPYSGSPANFAAYTGLLQP
HERIMGLDLPSGGHLTHGYYTAGGKKISATSIYFESLPYKVSSETGYVDYDKLEEKAMDF
RPKLIICGGSAYPRDWDYARFRAIADKCGAMLLCDMAHISGLVAAQEAANPFQYSDVVTT
TTHKSLRGPRSGMIFYRKGLKPPKKGQPEGALYDYEDRINFAVFPSLQGGPHNHQIAALA
VGLKQTMSPGFKSYIKQVKANAVALGNHLMSKGYKLVTDGTENHLVLWDLRPLGLTGNKV
EKVCDLCSITLNKNAVFGDSSAMSPGGVRIGTPAMTSRGLVEEDFVQIAEFLHQAVTICL
DVQKERGKLLKYFNEGLENNKDIEDLRAEVEKFATSFEMPGFRVSDMKYKD
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcgatggcttcgcaccacctcgcccagccgcccacgcgcgcggctctctcctcgcgc
cccacctacccgctctccagccatcaccactcctcccgtctccagctcccgctcgtcagc
ggggcgcggcgcagcaggctgtcccccgcggtggcgacgtccccggtcgccgccccagcg
atggacgccgtggccgactgggggctgaccactctggaggaggctgacccggaggtgtac
gacctcgtcgagcgcgagaagcggcggcagcgcgcgggcgtcgagctcatcgcgtcggag
aacttcacctcgctcgccgtcatggaggcgctgggctcgccgctcaccaacaagtactcc
gagggcatgccggggtcccgctactacggaggcaacgaggtcatcgacgaggtggaggag
ctctgccgcgcccgcgcgctcgccgccttccacctcgaccccgaggcctggggcgtcaac
gtgcagccctactccggctcgccggcgaacttcgccgcctacaccgggctgctccaaccc
cacgagcggatcatggggctcgatttgccgtccggcggccacctcacgcacggctactac
accgccggcggcaaaaagatctccgccacgtccatctacttcgagagcctgccgtacaag
gtgagctccgagacaggatacgtcgattatgataagctggaggagaaggccatggatttt
cggcccaagctcatcatctgcggcgggagcgcgtacccgcgggattgggattacgccagg
ttcagggccatcgcggataagtgcggcgccatgttgctctgcgacatggctcacatcagt
ggcctagttgccgcgcaggaggctgcaaatccttttcaatattctgatgtggttaccacc
accacccacaagagtctccgagggccaagatctggtatgatcttctacaggaagggcctg
aagcctcccaagaaaggccagcctgagggcgctctgtatgactacgaggacaggatcaac
ttcgcagtgtttccgtcgctccaagggggccctcacaaccaccaaattgctgcgctagcg
gttggtttgaagcagactatgtcacctggattcaagtcttatattaagcaggtcaaggcc
aatgctgttgcccttggtaaccatttgatgagtaagggctacaaattggttactgacgga
acagagaaccatcttgttctctgggatctgcgccctcttggcttgactggtaacaaagtt
gagaaggtctgtgatttgtgcagcattacactgaacaaaaatgctgtctttggggatagc
agtgcaatgtcacctggtggtgtccgcattggtacacctgccatgacatcaaggggtttg
gtagaggaggactttgtacagatcgccgagttccttcaccaggcagtgaccatctgcttg
gatgttcagaaggagcgtggcaagcttctcaagtacttcaacgagggcctggagaacaac
aaggacattgaggacctcagggcggaggtggagaagtttgccacttcattcgagatgcct
ggcttcagggtatccgacatgaagtacaaggattag

DBGET integrated database retrieval system