KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324793
Entry
4324793           CDS       T01015                                 
Name
(RefSeq) uricase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00232  Caffeine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4324793
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    4324793
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     4324793
SSDB
Motif
Pfam: Uricase SOR
Other DBs
NCBI-GeneID: 4324793
NCBI-ProteinID: XP_015622191
UniProt: Q94CU3 A0A8J8YAU9
LinkDB
Position
1:complement(37440676..37444692)
AA seq 307 aa
MADRLELQGRHGKSRVRVSRVWRRPAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVA
TDSIKNTVYVKAKECTEIVSMEEFAVILGRHFTSLYPQVSEATVTIAERPWERVVVDGKP
HSHGFKLGVEKHVTEVIVKKSGNLLINSGIQGYSLLKTTQSGFEKFVRDRYTLLPDTRER
IVATEVTAWWRYPFEHVSQIPSKSFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQNTLY
LMAKEVLNRFPDIASVQLRMPNLHFIPVNLGNKENPGLVKFADDVYLPTDEPHGTIEATV
SRPKSKL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggccgatcgcctcgagctccagggcaggcacggcaagtcccgcgtccgcgtctcccgc
gtctggcgccgccccgcggccgcgggaggccacgtcatcgtcgagtggaacgtggccgtc
agcgtcgtctccgactgcctcccctcctacacctccgacgacaactccgccatcgtcgcc
accgattccatcaagaacaccgtgtatgtgaaggccaaggaatgcacggagattgtctcc
atggaggaattcgcggtgattcttggaaggcatttcacctcgctgtacccgcaggtctca
gaggcaacggtgaccatcgccgagcgtccatgggagcgtgtggttgtcgatgggaagcct
cattcccacgggttcaaacttggtgttgagaagcacgtcacagaggtcattgtgaagaag
tctggaaacttgctcataaattctggaatccaaggatactccctgctaaagacaactcag
tccgggttcgaaaaatttgtgagggatcgctacacacttcttcctgatacaagagaaagg
attgtagcaacagaagtaactgcctggtggaggtatccttttgagcatgtttcccagatt
ccatcaaagtcattctgcttcacacaaaggtatcaggacgtaaagaaagttcttgcagat
acgttctttggtcctcctgatgttggagtgtatagtccatcagtgcagaatacactatac
ctgatggctaaggaagttctcaacaggttcccggatatagcatctgttcagctaaggatg
ccgaacctccactttatccctgttaacttagggaacaaagaaaatccaggattagtgaag
tttgctgatgatgtgtacctgccgaccgatgaaccacacgggaccattgaagcaacagtg
agccgccccaagtcaaagttgtaa

DBGET integrated database retrieval system