KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324809
Entry
4324809           CDS       T01015                                 
Name
(RefSeq) steroid 5-alpha-reductase DET2
  KO
K09591  steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4324809
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     4324809
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 4324809
NCBI-ProteinID: XP_015629510
UniProt: Q8LQ34 A0A0P0VAI9
LinkDB
Position
1:36666928..36668077
AA seq 268 aa
MGGGGGDDALYARCLVILYLISPITVFLLRFVSAPYGKLSRPGWGPAVPAALAWFLMESP
TMCLPPLVLSAAASSSALRAAALLPAALYALHYVNRTLVHPLRLLRLRRAPAPVPILVAA
FAFGFNLLNAYVQARSWALDAAAPHSTATATATPAAVARCLVGLALFAWGMRTNIAADKA
LLRLKEAGKGYQIPRGGLFDVVTCPNYFGEAVEWLGYALVAWTPAAWAFFLYTCSNLGPR
ARDHRRWYVGKFGDKYPASRKAFVPYIY
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcggcggcggcggcgacgacgcgctgtacgcgcgatgcctggtgatcctgtacctg
atcagcccgatcaccgtgttcctgctccggttcgtgtcggcgccgtacgggaagctctcc
cgccccgggtggggtcccgccgtgccggcggcgctcgcgtggttcctcatggagagcccc
accatgtgcctcccgcccctcgtcctctccgccgccgcctcctcgtcggcgctgcgcgcc
gccgctctcctcccggccgcgctgtacgcgctccactacgtgaaccgcacgctcgtccac
ccgctccggctcctccgcctccgccgcgcgccggcgcccgttccgatcctcgtcgccgcc
ttcgccttcggcttcaacctcctcaacgcctacgtccaggcgcgctcctgggcgctcgac
gccgccgctccccacagcaccgccaccgccaccgccacgcccgcggccgtcgcccgctgc
ctcgtcgggctagccctcttcgcgtgggggatgcggaccaacatcgcggcggacaaggcg
ctcctgaggctgaaggaggccgggaaagggtaccagattccccgcggcgggctgttcgac
gtggtcacctgccccaactacttcggcgaggccgtggagtggctcggctacgcgctggtg
gcgtggacgccggcggcctgggccttcttcctctacacctgctccaacctcgggccgagg
gccagggatcaccgccggtggtacgtcggcaagttcggcgacaagtacccggcgtcgcgc
aaggcgttcgtcccgtacatctactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272051
Entry
9272051           CDS       T01015                                 
Name
(RefSeq) steroid 5-alpha-reductase DET2
  KO
K09591  steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    9272051
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     9272051
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 9272051
NCBI-ProteinID: XP_015615377
UniProt: A0A0N7KSJ2 C7J8H0
LinkDB
Position
11:4252402..4256021
AA seq 272 aa
MTDRQAMAMGSSDGDVLYARCLVTLYLLSPLNVFALWFMSAPYGKLSRPGWGPTVPAALA
WCLMESPTLWLPPLVLSATTTSLSTPTLRVTILPAALYMLHYVHRTLVHPLRLLRLRRAP
APMPILIIMFGFSFNLLNAYIQARSWALDAVPPATATPLTVARCLVGLALFVWGMWTNIA
ADRELLRLKEAGKGYQIPKDGLFDLVACPNYFGETVEWLGYALVAWTPAAWAFFLYTCVN
LGPRARDQRLWYISKFGDKYPASRKAFIPYIY
NT seq 819 nt   +upstreamnt  +downstreamnt
atgactgaccggcaagccatggctatgggcagcagcgacggtgacgtgctgtatgcccga
tgcctggtcacactgtacctgctcagcccgctcaatgtgttcgcgctctggttcatgtcg
gcaccgtacgggaagctgtcccgcccggggtggggtcccacggtgccggcagcactcgcc
tggtgcctcatggagagccccaccctctggctcccaccccttgtcctctccgccaccacc
acctccttgtcaaccccgacgctgcgcgtcaccatcctcccggcggcgctgtacatgctc
cactacgtgcaccgcacgctcgtccacccactccggcttctccgcttgcgccgtgccccg
gcgcccatgccgatcctcatcatcatgtttggcttcagcttcaacctcctcaacgcctac
atccaggcacgttcttgggcgctcgatgctgtgcctccagccaccgccacgccactcact
gttgcccgctgtctcgttgggctggccctcttcgtgtgggggatgtggaccaacattgca
gcagacagggagctgctgaggctcaaggaggctggcaaagggtaccagattcccaaggac
gggctgttcgatttggtcgcctgccccaactacttcggcgagaccgtggagtggcttggc
tatgccctggtagcatggacgcctgcggcctgggccttcttcctctacacctgcgtcaac
ctcggaccgagggcgagagaccagcgcctgtggtacatcagcaagttcggagacaagtac
ccggcgtcgcgcaaggcgttcatcccgtacatctactaa

DBGET integrated database retrieval system