KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324844
Entry
4324844           CDS       T01015                                 
Name
(RefSeq) stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4324844
   01040 Biosynthesis of unsaturated fatty acids
    4324844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324844
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4324844
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4324844
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4324844
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4324844
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4324844
NCBI-ProteinID: XP_015630103
UniProt: Q8LJJ9
LinkDB
Position
1:38224372..38225994
AA seq 381 aa
MQVVGTVRVSGCGAVVAPSRRQCRVSAAVLTAAETATATRRRVTHSMPPEKAEVFRSLEG
WARSSLLPLLKPVEECWQPTDFLPDSSSEMFEHQVHELRARAAGLPDEYFVVLVGDMITE
EALPTYQTMINTLDGVRDETGASACPWAVWTRTWTAEENRHGDILGKYMYLSGRVDMRMV
EKTVQYLIGSGMDPGTENNPYLGFVYTSFQERATAVSHGNTARLARAHGDDVLARTCGTI
AADEKRHETAYGRIVEQLLRLDPDGAMLAIADMMHKRITMPAHLMHDGRDMNLFDHFAAV
AQRLNVYTARDYADIVEFLVKRWKLETLETGLSGEGRRARDFVCGLAKRMRRAAERAEDR
AKKDEQRKVKFSWIYDREVIV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgc
cggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcgg
cgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaaggg
tgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacg
gacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcg
cgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgag
gaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagacc
ggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgc
cacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtc
gagaagaccgtccagtacctcatcggctccggcatggatccggggacggagaacaacccg
tacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaac
acggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatc
gccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcgg
ctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatg
cccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtg
gcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtc
aagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgg
gacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagg
gctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgatt
gtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327738
Entry
4327738           CDS       T01015                                 
Name
(RefSeq) stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4327738
   01040 Biosynthesis of unsaturated fatty acids
    4327738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4327738
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4327738
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4327738
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4327738
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4327738
SSDB
Motif
Pfam: FA_desaturase_2 Exonuc_V_gamma
Other DBs
NCBI-GeneID: 4327738
NCBI-ProteinID: XP_015622023
UniProt: Q8S059 A0A0N7KEB1
LinkDB
Position
1:complement(40146777..40150895)
AA seq 400 aa
MASRMALRPNDVTLRLTPPLAAAARRNRRAAAGGVRVYAVASGAVSTKVENKKPFAPPRE
VHVQVTHSMPPQKIEIFKSLDDWARDNILSHLKPVEKCWQPQDFLPDPASDGFHDEVKEL
RERAKEIPDDYFVCLVGDMITEEALPTYQTMLNTLDGVRDETGASPTAWAVWTRAWTAEE
NRHGDLLNKYLYLTGRVDMRQIEKTIQYLIGSGMDPRTENNPYLGFIYTSFQERATFISH
GNTARHAKDFGDLKLAQICGIIASDEKRHETAYTKIVEKLFEIDPDGTVLAFADMMKKKI
SMPAHLMFDGEDDKLFEHFSMVAQRLGVYTAKDYADILEFLVSRWKISDLTGLSSEGNKA
QDYLCTLAARIRRLDERAQSRAKKAGTLPFSWVYGREVQL
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcgtcgaggatggcgctccggcccaacgacgtcacgctccgcctcaccccgcccctc
gccgccgccgcgcggcgcaaccgccgcgccgccgccggcggtgtcagggtctacgccgtc
gcgtccggggccgtctccaccaaggttgagaacaagaagccatttgctcctccacgagag
gtgcacgtccaggttacacattccatgccaccccagaagattgaaatattcaagtctctt
gatgattgggccagagataatattttgtcccaccttaagcctgtcgagaaatgttggcaa
ccacaggattttcttcctgatccagcctcagatgggtttcatgatgaagtcaaagaactt
agagaacgtgccaaggaaattcctgatgattattttgtttgtttggttggagacatgatt
acggaggaagctcttcctacgtaccagactatgcttaacactctcgatggtgtccgagat
gaaacaggtgcaagccccactgcctgggctgtttggacaagggcatggactgctgaggag
aacaggcatggtgacctcctgaacaaatatctctacctcactggtagggtggacatgaga
caaattgagaagacaattcagtatcttattggctctggaatggaccctaggacagagaac
aatccttatcttggattcatctacacctccttccaagagcgtgcgaccttcatctcacat
gggaacactgctcgccatgccaaagactttggcgacctaaaacttgcacagatctgtggc
atcatcgcctcagatgagaagcgtcatgagactgcatacaccaagattgttgagaagctg
tttgagattgaccctgatggcactgtgcttgcttttgctgacatgatgaagaagaagatc
tcgatgcctgcccacctgatgttcgatggggaggatgataagctctttgagcacttctcc
atggttgcacagaggcttggtgtttacaccgccaaggactacgccgacatccttgagttc
ctcgttagcaggtggaagatatctgacctgactggcctatctagcgagggaaacaaggcg
caagactacctttgcacccttgctgctaggatcagaaggctggatgagagggcacaatcg
agagccaagaaagctggtacattgcctttcagctgggtatatggtagggaagttcaactc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329432
Entry
4329432           CDS       T01015                                 
Name
(RefSeq) acyl-[acyl-carrier-protein] desaturase 3, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4329432
   01040 Biosynthesis of unsaturated fatty acids
    4329432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4329432
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4329432
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4329432
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4329432
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4329432
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4329432
NCBI-ProteinID: XP_015623425
UniProt: B9F058
LinkDB
Position
2:complement(17952014..17957566)
AA seq 402 aa
MSLTGCLPPRPPCSMRRRTSGGGASVSPVVAMASTAGVGGIGNPTPRGKKPFAPWREVPP
QVTHTLPPEKKEVFDSLEGWAADTILPYLKPVEESWQPQDHLPDPRSPSFGDEVAALRER
AAGLPDDHLVCLVGDMVTEEALPTYQTMLNTMDGGVRDETGAGGSAWAVWTRAWAAEENR
HGDLMNKYLYLTGRVDMRQVEKTIQYLIGSGMDPRTENDPYMGFIYTTFQERATSISHGN
TARHAGRHGDAALARVCGTVAADEKRHEAAYAAIVAKLFEVDPDYTVRAFARMMRRKVAM
PARLMYDGADDRLFARFAAVAQRLGVYTAADYAGIIEFLVARWGVPGLAAGLSGEGRRAQ
DFVCSLGPRFRRMEERAQEAAKRAPPAAAAPFSWIHGRQVQL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtctctcacgggatgcctccctcctcggccgccatgctcgatgaggaggagaaccagt
ggaggaggagcctctgtctctcctgtcgtggcgatggcgtccacggcaggagttggcggc
atcggcaaccccaccccgagaggcaagaagcccttcgccccgtggcgcgaggtgccaccc
caggtgacccacacgctgccgccggagaagaaggaggtcttcgactccctggaggggtgg
gcggcggacaccatcctcccctacctcaagcccgtggaggagtcgtggcagccgcaggac
cacctcccggacccgcgctcgccgtcgttcggcgacgaggtggcggcgctgcgggagcgc
gcggcggggctccccgacgaccacctggtgtgcctcgtcggcgacatggtcaccgaggag
gcgctccccacgtaccagacgatgctcaacaccatggacggcggggtgcgcgacgagacc
ggcgccggcggcagcgcctgggccgtgtggaccagggcgtgggccgccgaggagaaccgg
cacggcgacctgatgaacaagtacctctacctcaccggcagggtcgacatgaggcaggtc
gagaagacgatacagtacctcattggctccggcatggatccacgaacggagaacgacccg
tacatggggttcatctacacgacgttccaggagcgcgccacctccatctcccacggcaac
acggcgcgccacgcggggcgccacggcgacgccgccctggcccgcgtctgcggcaccgtc
gccgccgacgagaagcgccacgaggccgcctacgccgccatcgtcgccaagctcttcgag
gtggacccggactacacggtcagggccttcgcccgcatgatgcgccgcaaggtcgccatg
ccggcgcgcctcatgtacgacggcgccgacgaccgcctcttcgcccgcttcgccgccgtc
gcgcagcgcctcggcgtgtacaccgccgccgactacgccgggatcatcgagttcctcgtc
gcgaggtggggcgtccccggcctcgccgcggggctttccggcgaagggcggcgcgcgcag
gacttcgtctgcagcctcgggccgaggttcaggaggatggaggagagggcgcaggaggcg
gcgaagcgggcgccgcccgccgccgccgctccgttcagctggatccatggccgtcaggtg
cagctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333144
Entry
4333144           CDS       T01015                                 
Name
(RefSeq) acyl-[acyl-carrier-protein] desaturase 4, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4333144
   01040 Biosynthesis of unsaturated fatty acids
    4333144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4333144
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4333144
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4333144
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4333144
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4333144
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4333144
NCBI-ProteinID: XP_015629339
UniProt: Q84MF1
LinkDB
Position
3:complement(17623505..17625106)
AA seq 418 aa
MASSGLAVAATASSAWLCCPNHHIHTSSSRSRKHLLLHGLYGSAPARTRGRRPPVWTAAA
ATAAAPADTAASARREQVEIARSLNAWVEENMLPLLTPVDSAWQPHDFLPCSAAGGGEAL
AAFTEGVAELRAGAAGVPDEVLVCLVGNMVTEEALPTYQSMGNRAEGLADGTGVSPLPWA
RWLRGWTAEENRHGDLLNRYLYLSGRVDMRQVEATVHRLLRNGMEMLAPASPYHGLIYGA
FQERATFISHGHTARLAGQHGDRALAKICGVIAADERRHEAGYTMASGRLFELDPDGMAR
ALADVMRGKVTMPGQLMSDGRDGDGEHSLFARFSAVAERAGVYTARDYGDLVEHFVRRWR
VAELAAGLSGEGRRAQEYLCGLAPKIRRMEELAHRRAARIEPAMARFSWIFDRPVMLG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgtcttcaggcctcgcagttgcagcaacagcctcgtcagcctggctctgctgcccc
aatcatcacatccataccagcagcagcagatctcgcaagcatcttcttctccatggcctg
tacgggtctgcacctgcacgtactaggggacgacggccgccggtgtggactgcggcggcg
gccaccgcagcagcgccggcggacacggcggcgtcggcgcggcgggagcaggtggagatc
gcccggtcgctgaacgcgtgggtggaggagaacatgctcccgctgctcacccccgtcgac
tccgcgtggcagccgcacgacttccttccctgctcggccgcgggcggcggcgaggcgctg
gcggcgttcacggagggcgtggccgagctgcgcgcgggcgccgccggcgtgccggacgag
gtgctggtctgcctcgtggggaacatggtgacggaggaggcgctcccgacgtaccagagc
atgggcaaccgcgccgagggcctcgccgacggcaccggcgtgagccccctcccctgggcg
cgctggctccgcggctggaccgccgaggagaaccgccacggcgacctcctcaaccgctac
ctctacctctccggccgcgtcgacatgcgccaggtcgaggccaccgtgcaccgcctcctc
cgcaacggcatggagatgctggcgccggcgagcccgtaccacggcctgatctacggcgcg
ttccaggagcgcgccaccttcatctcccacggccacacggcgaggctcgcggggcagcac
ggcgaccgggcgctcgccaagatctgcggcgtgatcgccgccgacgagaggcggcacgag
gcgggctacacgatggcgtccggcaggctgttcgagctcgacccggacggcatggcgcgc
gcgctggcggacgtcatgcgcgggaaggtgaccatgccggggcagctcatgtcggacggc
cgcgacggcgacggcgagcacagcctgttcgcccggttctccgccgtggcggagcgcgcc
ggcgtgtacacggcgagggactacggcgacctcgtcgagcacttcgtgcggaggtggcgg
gtggcggagctcgcggcggggctctccggcgagggccgacgcgcgcaggagtacctgtgc
gggttggcgcccaagatccggaggatggaggagctggcccaccggagggcggcccgcatc
gagcccgccatggcccgtttcagctggatcttcgataggcccgtcatgctgggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335627
Entry
4335627           CDS       T01015                                 
Name
(RefSeq) stearoyl-[acyl-carrier-protein] 9-desaturase 5, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4335627
   01040 Biosynthesis of unsaturated fatty acids
    4335627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4335627
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4335627
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4335627
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4335627
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4335627
SSDB
Motif
Pfam: FA_desaturase_2 Rubrerythrin
Other DBs
NCBI-GeneID: 4335627
NCBI-ProteinID: XP_015636259
UniProt: Q40731
LinkDB
Position
4:complement(18560189..18564412)
AA seq 390 aa
MAFAASHTASPSSCGGVAQRRSNGMSPVVAMASTINRVKTAKKPYTPPREVHLQVKHSLP
PQKREIFDSLQPWAKENLLNLLKPVEKSWQPQDFLPDPSSDGFYDEVKELRERAKEIPDD
YFVCLVGDMVTEEALPTYQTMLNTLDGVRDETGASPTTWAVWTRAWTAEENRHGDLLNKY
MYLTGRVDMKQIEKTIQYLIGSGMDPGTENNPYLGFLYTSFQERATFISHGNTARHAKEY
GDLKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDYTVLAFADMMRKKISMPAHLMYDG
KDDNLFEHFSAVAQRLGVYTARDYADILEFLVQRWKVADLTGLSGEGRRAQDFVCTLAPR
IRRLDERAQARAKQAPVIPFSWVYDRKVQL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcgttcgcggcgtcccacaccgcatcgccgtcctcctgcggcggtgtggcgcagagg
aggagcaatgggatgtcgccggtggtggccatggcctccaccatcaacagggtcaagact
gctaagaagccctacactcctccacgtgaagttcatctccaagtcaagcattcactgcca
ccccaaaagcgggagattttcgattcgcttcaaccttgggccaaagagaaccttttgaac
ctcctgaagccagttgagaagtcatggcagccacaggacttcctgccagacccttcttcc
gatgggttttatgatgaagtaaaagagctgcgggagagggctaaggagatccctgatgac
tactttgtttgcttagttggagacatggttactgaggaagctcttcctacctatcaaaca
atgcttaacacccttgatggtgtccgagatgaaactggcgcaagcccaaccacctgggct
gtttggacaagagcatggactgctgaagagaacaggcatggtgatcttcttaataagtac
atgtaccttactggacgtgttgacatgaaacaaattgagaagacaatacaatacctgatt
gggtctgggatggatccaggaactgagaataatccctacttgggtttcctttacacatca
tttcaagaaagagctacatttatatcccatggcaatactgcaaggcacgccaaggagtac
ggggaccttaagctggctcagatatgtgggacaatagcagctgatgagaagcgccatgag
acagcttacaccaagatagtggagaagctcttcgagattgatcctgactacacagttctt
gcatttgctgacatgatgaggaagaagatctcaatgcctgctcatctgatgtatgacggc
aaggacgacaacttgttcgagcatttcagcgctgtggcacagcggctgggtgtctacact
gcaagagactatgccgacatcctggagttcttggtccagaggtggaaagtcgcagatctc
accgggctgtccggagaagggagaagggctcaggatttcgtctgcacgttggcgccgaga
atcaggcggctggatgaaagagcccaagcaagagctaagcaagcgcctgttattcctttc
agctgggtttatgaccgcaaagtgcagctttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344895
Entry
4344895           CDS       T01015                                 
Name
(RefSeq) acyl-[acyl-carrier-protein] desaturase 6, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4344895
   01040 Biosynthesis of unsaturated fatty acids
    4344895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4344895
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4344895
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4344895
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4344895
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4344895
SSDB
Motif
Pfam: FA_desaturase_2 DUF1580
Other DBs
NCBI-GeneID: 4344895
NCBI-ProteinID: XP_015650772
UniProt: Q0J7E4
LinkDB
Position
8:complement(5751887..5753785)
AA seq 419 aa
MAATATMAMPLANRLRCKPNTNSSSPSRTLFGRRVTMISSSRWGSAVSGSAIMSAAADVA
AAVRREEDEEMRSYLSPEKLEVLTQMEPWVEEHVLPLLKPVEAAWQPSDLLPDPAVLGGE
GFHAACAELRERAAGVPDLLLVCLVANMVTEEALPTYQSSLNRVRAVGDLTGADATAWAR
WIRGWSAEENRHGDVLNRYMYLSGRFDMAEVERAVHRLIRSGMAVDPPCSPYHAFVYTAF
QERATAVAHGNTARLVGARGHGDAALARVCGTVAADEKRHEAAYTRIVSRLLEADPDAGV
RAVARMLRRGVAMPTSPISDGRRDDLYACVVSLAEQAGTYTVSDYCSIVEHLVREWRVEE
LAAGLSGEGRRARDYVCELPQKIRRMKEKAHERAVKAQKKPISIPINWIFDRHVSVMLP
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggctgcaacagcaacaatggcgatgcctttagctaataggcttcgttgcaaaccaaac
accaactcttcttcaccatcaagaacactatttggtagacgagtcaccatgatcagtagc
agccgctggggtagtgctgtcagtggcagcgcgatcatgtcggcggcggccgacgtcgcc
gccgccgtgcggcgggaggaagacgaggagatgaggagctacctgtcgccggagaagcta
gaggtgctgacgcagatggagccgtgggtggaggagcacgtgctgccgctgctgaagccg
gtggaggcggcgtggcagccgtcggacctgctcccggacccggcggtgctcggcggcgag
gggttccacgcggcgtgcgccgagctgcgggagcgcgccgccggcgtgccggacctgctc
ctggtgtgcctcgtggcgaacatggtgacggaggaggcgctgcccacgtaccagagctcg
ctgaaccgcgtccgcgccgtcggcgacctcaccggcgccgacgccacggcgtgggcgcgg
tggatccgcgggtggtccgccgaggagaaccgccacggcgacgtgctcaaccggtacatg
tacctctccggccgcttcgacatggccgaggtggagcgcgccgtgcaccgcctcatccgc
tccggcatggccgtcgacccgccgtgcagcccgtaccacgccttcgtctacacggcgttc
caggagcgcgccacggcggtcgcccacggcaacacggcgcggctggtcggcgcgcgaggg
cacggcgacgccgccctcgcccgcgtctgcggcaccgtcgccgccgacgagaagcggcac
gaggccgcctacacccgcatcgtctccaggctcctcgaggccgacccggacgccggcgtg
cgcgcggtggcgcgcatgctacggcgaggggtcgccatgccgacctcgcccatctccgac
ggccgccgcgacgacctctacgcctgcgtcgtgtccctcgccgagcaggccgggacgtac
acggtgtcggactactgctccatcgtcgagcacctggtgcgggagtggcgcgtggaggag
ctcgcggcggggctctccggcgaagggcggcgcgcgcgggactacgtgtgcgagctgccg
cagaagatccggaggatgaaggagaaggcccatgagagggcggtcaaggcccagaagaag
cccatcagcatcccgattaattggatatttgataggcacgtcagtgtcatgctgccctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344897
Entry
4344897           CDS       T01015                                 
Name
(RefSeq) acyl-[acyl-carrier-protein] desaturase 7, chloroplastic
  KO
K03921  acyl-[acyl-carrier-protein] desaturase [EC:1.14.19.2 1.14.19.11 1.14.19.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4344897
   01040 Biosynthesis of unsaturated fatty acids
    4344897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4344897
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.2  stearoyl-[acyl-carrier-protein] 9-desaturase
     4344897
    1.14.19.11  acyl-[acyl-carrier-protein] 4-desaturase
     4344897
    1.14.19.26  acyl-[acyl-carrier-protein] 6-desaturase
     4344897
Lipid biosynthesis proteins [BR:osa01004]
 Desaturase
  First
   4344897
SSDB
Motif
Pfam: FA_desaturase_2
Other DBs
NCBI-GeneID: 4344897
NCBI-ProteinID: XP_015649776
UniProt: Q6Z1I5
LinkDB
Position
8:complement(5787553..5789137)
AA seq 404 aa
MAASATTSTLAVTMFGYPNRNCHLKPPATATLRFWRSAAAAAVATSRREAEAEEADEVRR
CLAPARLEVLEQMEPWVEAHVLPLLKPAEEAWQPADLVPDAAALGADGFHAACVELRGRA
AGVPDAHLVCLVGNMVTEEALPTYQSMANRFESARDVTGADATAWARWIRGWSAEENRHG
DVLNRYMYLSGRLDMRQVERTVHRLIGSGMAMHAPASPYHGFIYVAFQERATAISHGNTA
RNVRAHGDDALARICGAIASDEKRHEAAYTRVVERLLEADPDTTVRALAYMMRRRITMPA
ALMDDGRDADLFAHYAAAAQQAGTYTASDYRGILEHLIRRWRVAELEAGLSGEGRRARDY
VCALPQKIRRMEEKAHDRAAQMRKRPTAIPFSWIFDKPVDLMLP
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcggcatcggcaacgacctccaccttagcagtaaccatgtttgggtatccaaaccgc
aactgtcacctcaagccgccggcaactgccactctccgattctggcggagcgcggcggcg
gcggcggtggcgacgtcacggcgggaggcggaggcggaggaggcggacgaggtgaggagg
tgcctggcgccggcgaggcttgaggtgctggagcagatggagccgtgggtggaggcgcac
gtgctgccgctgctgaagccggcggaggaggcgtggcagccggcggacctggtgcccgac
gcggcggcgctcggcgccgacgggttccacgcggcgtgcgtcgagctccgggggcgcgcc
gccggcgtgcccgacgcgcacctggtgtgcctggtggggaacatggtgacggaggaggcg
ctccccacgtaccagagcatggcgaaccggttcgagtcggcgcgcgacgtcaccggcgcc
gacgcgacggcgtgggcgcggtggatccgcgggtggtccgccgaggagaaccgccacggc
gacgtgctcaaccgctacatgtacctctccggccgcctcgacatgcgccaggtggagcgc
acggtgcaccggctgatcggctccggcatggcgatgcacgcgccggcgagcccctaccac
ggcttcatctacgtcgcgttccaggagcgcgccaccgccatctcccacggcaacacggcg
cgcaacgtccgcgcccacggcgacgacgcgctcgcccgcatctgcggcgccatcgcctcc
gacgagaagcgtcatgaggccgcctacacccgcgtcgtcgagaggctcctcgaggccgac
ccggacaccaccgtgcgcgcgctggcgtacatgatgcgccgccggatcaccatgcccgcc
gcgctcatggacgacggccgcgacgccgacctgttcgcccactacgccgcggcggcgcag
caggccgggacgtacaccgcgtcggactaccggggaatcctcgagcacctgatacggcgg
tggcgcgtggcggagctggaggcggggctctccggcgaggggcggcgcgcgcgggactac
gtgtgcgcgctgccgcagaagatccggaggatggaggagaaggcccatgacagagcggcc
cagatgaggaaaaggcccacggccattccatttagctggatctttgataagcccgtggat
ctcatgctgccctaa

DBGET integrated database retrieval system