KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324853
Entry
4324853           CDS       T01015                                 
Name
(RefSeq) delta-1-pyrroline-5-carboxylate synthase-like
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4324853
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     4324853
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     4324853
SSDB
Motif
Pfam: AA_kinase Aldedh
Other DBs
NCBI-GeneID: 4324853
NCBI-ProteinID: XP_015622203
UniProt: Q941T1
LinkDB
Position
1:36430935..36440402
AA seq 735 aa
MGRGGIGGAGLVAAVAKADVENTDSTRGFVKDVKRIIIKVGTAVVTGPNGRLAMGRLGAL
CEQVKQLNFEGYEVILVTSGAVGVGRQRLKYRKLVNSSFADLQNPQMDMDGKACAAVGQS
VLMAIYDTLFSQLDVTSSQLLVTDRDFMDPSFGNQLRETVNSLLDLKVIPVFNENDAIST
RRQPYEDSSGIFWDNDSLARLLAQELKADLLIMLSDVEGLYSGPPSDPQSKIIHTYVHEQ
HGKLISFGEKSRVGRGGMQAKVAAAFTASSKGIPVVIASGFAIDSIIKVMRGEKIGTLFH
REANQWGCSKEATAREMAVAARDCSRHLQKLSSEERKKILLDIADALEANEDLITSENQA
DLDLAQDIGYDKSLVARMTIKPGKIKSLAGSIREIADMEDPISHTLKRTEVAKDLVFEKT
YCPLGVLLIIFESRPDALVQIASLAIRSGNGLLLKGGKEAMRSNTILHKVITGAIPDVVG
KKLIGLVKNKDEIADLLKLDDVIDLVIPRGSNKLVSQIKAATKIPVLGHADGICHVYIDK
SADMDMAKRIVLDAKVDYPAACNAMETLLVHKDLNRTEGLDDLLVELEKEGVVIYGGPVA
HDTLKLPKVDSFHHEYNSMACTLEFVDDVQSAIDHINRYGSAHTDCIITTDGKAAETFLQ
QVDSAAVFHNASTRFCDGARFGLGAEVGISTGRIHARGPVGVDGLLTTRCILRGSGQVVN
GDKGVVYTHRELPLQ
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggggagaggagggatcggcggcgcggggctggtggcggcggtcgcgaaggcggacgtg
gagaacaccgactccacccgcggcttcgtcaaggacgtgaagcgcatcatcatcaaggtc
ggcaccgctgttgtgactgggccgaatggccggttggctatgggcaggctcggtgctctg
tgtgaacaggtgaagcagctaaattttgaggggtacgaggtgattctggtcacctctggt
gctgttggtgttgggaggcagaggctcaagtaccggaagctcgtcaatagcagtttcgct
gatctgcagaacccacagatggacatggacgggaaggcctgcgctgccgtcggtcagagt
gtgctgatggcgatctatgacacgttatttagccagcttgacgtaacatcatctcagctt
cttgttacggatcgtgattttatggatccaagttttgggaaccagctccgcgagactgtt
aattctctgttagatctcaaggttataccagtatttaatgagaatgacgccatcagtacc
aggaggcaaccatacgaggattcatctggcatattctgggataacgatagtttggccaga
ctgttagcgcaagaacttaaagctgatctccttatcatgctcagtgatgtggaggggctc
tatagcggtccacctagcgatccacaatcgaagattatccacacatacgtccatgaacaa
catgggaagttaattagctttggggagaaatctcgtgtgggaagaggtggaatgcaagct
aaagtagcagctgcttttactgcttcatcaaaaggaatacctgttgtaattgccagtgga
tttgcaatcgatagcattattaaggtcatgcgaggagagaaaatcggtacgcttttccat
agggaagcaaaccagtggggttgttccaaggaagcaacagcgcgtgagatggccgttgct
gcaagagattgctccagacatctacagaaattgtcgtctgaggagcgtaagaagattttg
ctagacatcgccgatgctctagaagcaaatgaagatctaattacatccgagaaccaagct
gatctggatttggcgcaagatattggttacgataaatcattggttgctcggatgaccata
aagccaggaaagataaaaagcctcgcaggatcaattcgtgaaatcgctgatatggaggac
cctatttcccatacactgaaaagaacagaggttgctaaagatcttgtttttgagaaaaca
tattgcccattgggtgttctcctaattatttttgagtcccgtcctgatgccttggtacag
attgcatctttagcaatccgaagtggaaatggtcttctcttgaaaggaggaaaagaagct
atgagatcaaacacaatactgcataaggtcataactggtgcaattccagatgttgttggt
aaaaaacttattggcctagtgaaaaacaaagatgaaattgctgatttgctcaagcttgat
gatgtgattgatcttgtaataccaagaggtagcaataagctcgtttcccagatcaaagca
gcaaccaagattcctgttcttggtcatgctgacggtatctgccatgtttatattgacaaa
tcagctgacatggacatggcaaaacgtattgtattggacgcaaaggttgattatccagca
gcgtgtaatgccatggaaacgttacttgttcataaagatctgaacaggacagaaggcctt
gacgatttattggtggagcttgaaaaggaaggggtagttatctatggcgggcctgttgca
catgacactttgaaactaccaaaggtagattcatttcatcatgagtataactcaatggca
tgcaccctcgaatttgttgatgatgtgcagtcagcaattgaccatataaatcgctatgga
agtgcacacacagattgcattatcactactgatggaaaggcagcagagacttttctacag
caagttgatagtgctgcggtattccataatgcaagcacacggttctgtgatggggctcgc
tttggtctaggtgctgaggttggcataagcacagggcgcatacatgctcgggggcctgtt
ggcgttgatggactcctaacaactcgatgcattttacgaggaagtggacaagtagtgaac
ggcgacaagggagttgtttacacccacagggagctccctttgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338979
Entry
4338979           CDS       T01015                                 
Name
(RefSeq) delta-1-pyrroline-5-carboxylate synthase
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4338979
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     4338979
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     4338979
SSDB
Motif
Pfam: AA_kinase Aldedh
Other DBs
NCBI-GeneID: 4338979
NCBI-ProteinID: XP_015640176
UniProt: O04226
LinkDB
Position
5:complement(22374199..22380914)
AA seq 716 aa
MASVDPSRSFVRDVKRVIIKVGTAVVSRQDGRLALGRVGALCEQVKELNSLGYEVILVTS
GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ
LLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPYEDSSGIFWDNDSLA
GLLALELKADLLILLSDVDGLYSGPPSEPSSKIIHTYIKEKHQQEITFGDKSRVGRGGMT
AKVKAAVLASNSGTPVVITSGFENRSILKVLHGEKIGTLFHKNANLWESSKDVSTREMAV
AARDCSRHLQNLSSEERKKILLDVADALEANEDLIRSENEADVAAAQVAGYEKPLVARLT
IKPGKIASLAKSIRTLANMEDPINQILKKTEVADDLVLEKTSCPLGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEAIRSNTILHKVITDAIPRNVGEKLIGLVTTRDEIADLLKL
DDVIDLVIPRGSNKLVSQIKASTKIPVLGHADGICHVYIDKSADMDMAKHIVMDAKIDYP
AACNAMETLLVHKDLMKSPGLDDILVALKTEGVNIYGGPIAHKALGFPKAVSFHHEYSSM
ACTVEFVDDVQSAIDHIHRYGSAHTDCIVTTDDKVAETFLRRVDSAAVFHNASTRFSDGA
RFGLGAEVGISTGRIHARGPVGVEGLLTTRWILRGRGQVVNGDKDVVYTHKSLPLQ
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggcgagcgtcgacccgtcccggagcttcgtgagggacgtgaagcgcgtcatcatcaag
gtgggcactgcagttgtctccagacaagatggaagattggctttgggcagggttggagct
ctgtgcgagcaggttaaggaactgaactctttaggatacgaagtgattttggtcacctca
ggtgctgttggagtggggcgacagcgacttaggtaccggaagcttgtcaatagcagcttt
gctgatctgcaaaagccacagatggagttagatggaaaggcttgtgccgctgttggtcag
agtggactgatggctctttacgatatgttgtttaaccaactggatgtctcgtcatctcaa
cttcttgtcaccgacagtgattttgagaacccaaagttccgggagcaactcactgaaact
gttgagtcattattagatcttaaagttataccaatatttaatgaaaatgatgccatcagc
actagaaaggctccatatgaggattcatctggtatattctgggataatgacagtttagca
ggactgttggcactggaactgaaagctgatctccttattctgctcagtgatgtggatggg
ttgtatagtggtccaccaagtgaaccatcatcaaaaatcatacacacttatattaaagaa
aagcatcagcaagaaatcacttttggagacaaatctcgtgtaggtagaggaggcatgaca
gcaaaagtgaaggctgctgtcttggcttcaaatagcggcacacctgtggttattacaagt
gggtttgaaaatcggagcattcttaaagttcttcatggggaaaaaattggtactctcttt
cacaagaatgcgaatttgtgggaatcatctaaggatgttagtactcgtgagatggctgtt
gccgcaagagattgttcaaggcatctacagaatttgtcatcagaggaacgaaaaaagata
ttgctagatgttgcagatgctttggaggcaaatgaggatttaataaggtctgagaatgaa
gctgatgtagctgcggcccaagttgctggatatgagaagcctttggttgctagattgact
ataaaaccaggaaagatagcaagccttgcaaaatctattcgtacccttgcaaatatggaa
gaccctataaaccagatacttaaaaagacagaggttgctgatgatttagttcttgagaaa
acatcttgcccattaggtgttctcttaattgtttttgagtcccgacctgatgccttggtt
cagattgcatctttggcaattcgaagtggtaatggtcttctcctaaaaggtggaaaagaa
gctatcagatcaaacacgatattgcataaggttataactgatgctattcctcgtaatgtt
ggtgaaaaacttattggccttgttacaactagagatgagatcgcagatttgctaaagctt
gatgatgtcattgatcttgtcattccaagaggaagtaataagcttgtctctcaaatcaag
gcgtcaactaagattcctgttcttgggcatgctgatggtatatgccacgtatatattgac
aaatcagctgacatggatatggcaaaacatattgtaatggatgcaaaaattgattaccca
gcagcctgcaatgcaatggagaccttactagttcataaggatcttatgaagagtccaggc
cttgacgacatattagtagcactaaaaacagaaggagttaatatttatggtggacctatt
gcgcacaaagctctgggatttccaaaagctgtttcatttcatcatgagtatagttctatg
gcctgcactgttgagtttgttgatgatgttcaatcagcaattgaccatattcatcgttat
ggaagtgctcatacagattgtatcgtcactacagatgataaggtagcagagacttttcta
cgcagagttgatagtgctgctgtatttcataatgcaagtacgagattctctgatggggct
cgttttggattgggtgctgaggttggcataagcacagggcgtatccatgcccgtggacca
gtgggtgttgaaggtctcttaactacacgatggatcttgcgagggcgtgggcaagtggtg
aatggtgacaaggatgtcgtgtacacccataagagtcttcctttgcaatga

DBGET integrated database retrieval system