KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324904
Entry
4324904           CDS       T01015                                 
Name
(RefSeq) signal recognition particle subunit SRP72
  KO
K03108  signal recognition particle subunit SRP72
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4324904
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4324904
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4324904
SSDB
Motif
Pfam: SRP72 SRP_TPR_like TPR_14 TPR_19 ANAPC3 TPR_2 TPR_6 TPR_1 TPR_16 TPR_9 DUF3128
Other DBs
NCBI-GeneID: 4324904
NCBI-ProteinID: XP_015621360
UniProt: A0A0P0VBH6 Q5N842
LinkDB
Position
1:38650514..38654630
AA seq 669 aa
MPPKSKAAAAAAAAAAAQPVAVEDLFTTLHRHIEAGEFPQAVKVADQVLAAAPGDEDAVR
CKVVAHIKSDAIEKALAAIRAAERLPIDLSYCKAYCYYRQNKLQEALDLLKGQEETSAIL
QLESQIYYRLGRMNDCMNSYEKLQKFKVESMDLKINIIAALVAAGRASEVQATMKAQKVD
LSSRALRDTRSFELAYNSACSLIENKKYSEAKEQLDLAKRIGKEELMVDEYGDDDIEYEL
APVSAQLAYVHQLQGQTQEAMETYNNITSRNLADPSSLAVATTNLISLKGTRDAADSLRK
LSRLIEKSTAPNQLQLIESLESKLSPRQKEALYSAYVLLLLHANKIDQAHEFVSGLLGMF
QDSTFPVLLQAAVHVREKKVQKAEEVLSQYAEKHPENSKGVLLSLAQIAASANHFQIAAD
SLSKIVDIQHMPATVATLVALKERLGDSNGASSVLDSAIQWWKNSMTEDNKLEVFMREAA
TFKLNHGRDEEACQLYEDLVKSFGSAEALAGLVATSARTNLEKAEQYEKKLKPLPGLKGI
NVESLEKTSGARPFEAPKPMEQDVTDEVKKQKAKKRKRKPRYPKGFDPANPGPPPDPERW
LPKRERSSYRPKRKDKRAQVRGAQGAVSRDGTSSASASSSSKANQATKAPAAAPEPPKGS
NKSRKKKSR
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgccgcccaaatcgaaggcggcggcggcggcggccgccgccgcggcggcgcagccggtc
gccgtggaggacctcttcaccacgctgcaccgccacatcgaggccggcgagttcccgcag
gccgtcaaggtcgccgaccaagttctcgcggcggcgccgggcgacgaggatgcggtgcgg
tgcaaggtggtggcgcacatcaagtccgatgcgattgagaaggcgctcgccgcgatccgc
gccgccgagcgcctcccgatcgacctcagctactgcaaggcctattgctactacaggcaa
aataaactgcaagaagctctagacctattgaaaggtcaagaagaaacctctgctattctt
cagttggaatctcagatttattataggctaggtagaatgaatgattgcatgaatagctat
gagaagcttcagaaatttaaggttgagtcaatggatctgaagataaatatcattgctgct
ctggttgctgctggaagggcctctgaagttcaggcaaccatgaaggcacaaaaagttgat
ctctcctcgagggcactcagagatactcgaagctttgagcttgcatataattctgcctgc
tcgttgatagaaaataaaaagtattcagaagctaaagagcagctggacttggcaaaaaga
attgggaaagaagagcttatggtggacgaatatggagatgatgatattgaatatgaacta
gctcctgtgtctgctcagcttgcttatgtgcatcagctacaaggacaaacccaggaagct
atggaaacctataataatataacaagcaggaatttggcagatccctcatcacttgctgtg
gcaacaacgaaccttatctcgttgaaaggaaccagggacgctgctgatagcttgaggaag
cttagccggcttattgaaaaatctactgctcccaaccagttgcaacttatcgaaagcctt
gaatccaagctatcaccaaggcaaaaagaagctctgtattctgcatatgttcttttactc
ctccacgcgaacaaaattgatcaggcacatgagtttgtcagtggactacttggtatgttt
caggacagcacattccctgttttgcttcaagctgcagttcatgtgagagaaaagaaggtg
cagaaagctgaagaagttcttagccagtatgctgagaagcatcctgagaattctaaagga
gtcctcctttcgcttgctcagatcgctgccagtgccaatcattttcagattgctgctgat
tcattgtctaaaatagttgacatccagcacatgcctgctacagtcgctacactagtagct
cttaaagagcgccttggtgactctaatggtgcttcttctgtgcttgattctgctatccag
tggtggaagaattccatgactgaggataacaaattagaggtgttcatgcgggaggctgct
acatttaagctcaaccatgggcgtgacgaagaggcctgccaattgtatgaggatcttgtt
aagagctttggaagcgcagaagcgttggcggggctagtagcaacttcagcgcgcaccaac
cttgagaaagctgaacagtatgagaagaaactgaaaccattgccaggtctcaagggaatt
aatgttgagagcctggagaaaacttctggtgcaaggccttttgaggcgcccaaacccatg
gaacaggacgttactgacgaagtgaagaagcagaaggctaagaagaggaagaggaaacct
agatacccgaaaggctttgatccagcaaacccagggccaccaccagatccggagagatgg
ctacccaagagagagcggtcaagttaccgcccaaagaggaaggataagagggctcaggtc
agaggtgctcaaggagctgtgtcaagagatggaacttcatctgcgagcgccagttcatct
tcgaaagcaaaccaagccaccaaagctccagctgcagccccagaaccaccaaagggttcc
aacaagtcccggaagaaaaaatcgagatga

DBGET integrated database retrieval system