KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324905
Entry
4324905           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 7-like isoform X1
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4324905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4324905
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4324905
SSDB
Motif
Pfam: RNA_pol_Rpc4 Adhesin_P1_C
Other DBs
NCBI-GeneID: 4324905
NCBI-ProteinID: XP_015620942
LinkDB
Position
1:complement(38659386..38663696)
AA seq 286 aa
MDADGSSKKGPPGRRTRKKLKFKPKVPPQKPRKSVPEKPNLEQSKPIDEELMKRLKTGQG
ATKTLSSIKDEHSTQNPPSTVSSAASVSLTLPQSGGHNQGQLKKPFHITRAVPLDAIPGF
LYDDEDDDDDDDDEGDNNVELEEIRPSSTECESSIHPAEELNLLEQGDTRRMLLFQLPKS
LPLPRISAAVERNGKARDKEVKEGSNLKELPQGYLGKMVVYKSGKIKMKLGDVMFDVNPG
EECRMAQHVAAINTKEKHCCLLGEIESRHVVVTPDVDSLLLNDNRG
NT seq 861 nt   +upstreamnt  +downstreamnt
atggatgcagatggtagctccaagaaaggccctccaggtcgtcgcactagaaagaagctg
aagttcaagccaaaagtgccaccacaaaagccaagaaaatcagttccagaaaagccaaac
ctggaacagtcaaagccaattgatgaagaattgatgaagagactgaagactggccaagga
gctacaaaaacattgtcaagtataaaagatgaacactcaacacagaacccaccctcaact
gtttcttctgcagctagtgttagcttaacactgccacagtcaggagggcacaaccaaggc
caactgaagaagccattccacatcacaagagcggttcctcttgatgctattccaggattt
ttatacgacgatgaggatgatgatgacgacgacgacgatgagggcgataacaatgttgaa
ttagaggagattcgaccaagttcaactgaatgtgaatcttccatccatccagcagaagag
ctgaatttactcgagcaaggtgacacgagaagaatgctcctattccagttgccaaaatct
cttccgttgccaagaatatccgctgcagttgaaaggaatggaaaagccagggacaaggag
gtgaaagaaggatccaacttgaaagaattgccacaaggatatttgggcaaaatggtggtg
tacaagagcggcaagatcaagatgaagttgggggatgtcatgtttgatgtgaacccagga
gaagagtgtaggatggcacaacatgtggctgctatcaacaccaaagagaagcattgttgt
ttacttggcgagatcgagagccggcatgtcgttgtgactccagatgtggactcgctgctg
ttgaatgacaatagaggttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335691
Entry
4335691           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC4
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4335691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4335691
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4335691
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 4335691
NCBI-ProteinID: XP_015637004
LinkDB
Position
4:complement(19398494..19403749)
AA seq 309 aa
MMDSKGKVKKETDGLPPRKGGLKFAPKVRPKKAPKIVPKTEPAEESKDETVDKELLMKLK
TSQSTDPFVRKFKTEKKEMRTQVAFGQGNSSYARSFPMQSSADGSASKLPKEYVEPWDYT
HSDYPVTLPLRRPYSGDPEILNEEEFGESSATGAQDGELTTAEELGLMHRSDKAQLLFFQ
MPASLPLPKQPDSVAETDKGDGVDAEPTSTSSKEMHAGTRPPKVLGSKLKDLPEGFMGKI
LVYRSGKVKMKIGDSLFDVSPGSNCMFVQEVAAINAREKHCCTLGEISKRAIVTPDIEHL
LDSFDKMEA
NT seq 930 nt   +upstreamnt  +downstreamnt
atgatggatagcaagggcaaagtgaagaaggaaacggatggcctccctcctcgcaaggga
gggcttaaatttgcacccaaggttcgtcctaagaaagctccaaagatcgtcccgaaaacg
gagccggctgaggaaagcaaggatgaaaccgtagataaagagctgttgatgaagcttaag
acatcgcagagcacagatccctttgtgagaaaatttaagactgagaaaaaggaaatgcgt
actcaagttgcatttggacaggggaactcgtcgtatgcaagatcatttcccatgcaaagt
tcagcagatggatcagcttcaaaattaccaaaagaatatgttgaaccatgggactatacc
cacagtgactatcctgttactctcccactgaggagaccgtattctggagatcctgaaatt
cttaatgaagaggagtttggagagtcttctgccaccggagcccaagatggtgaattaacc
acagcagaagaacttggactaatgcatcggtcagacaaagcacagttgcttttcttccag
atgcctgcatctcttccattaccaaagcagccagactcagtcgcagagacagataaaggc
gatggggtggatgctgaacctacaagcacaagctctaaggagatgcatgcaggaacaagg
ccaccaaaagtccttggctctaagctcaaagaccttccagaaggtttcatggggaagata
cttgtatataggagcggtaaagtgaagatgaagatcggagattcactctttgatgtctct
ccgggttcaaattgcatgtttgtccaggaggttgcggcaattaacgccagagaaaagcac
tgctgcaccttgggagagatcagcaagcgcgcgattgtaaccccggacatcgagcatctg
ctggattctttcgacaagatggaagcgtaa

DBGET integrated database retrieval system