KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324914
Entry
4324914           CDS       T01015                                 
Name
(RefSeq) beta-hexosaminidase 3
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00513  Various types of N-glycan biosynthesis
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4324914
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4324914
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4324914
   00531 Glycosaminoglycan degradation
    4324914
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4324914
   00604 Glycosphingolipid biosynthesis - ganglio series
    4324914
   00511 Other glycan degradation
    4324914
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4324914
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4324914
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4324914
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4324914
NCBI-ProteinID: XP_015621104
UniProt: A0A0P0VBJ0
LinkDB
Position
1:complement(38740028..38745917)
AA seq 526 aa
MAQALSLGLLLAFLAIQSCIAIELTDHIDLWPMPTSVSHGTQRLYVSKDITMSMEGSTYP
DGKGILKDAFQRVVDLMKLNHVVDGANPSSFVLTGVNVVVHSPEDELKFGVDESYNLSVP
TAGYPLRVQIEAQTVFGALHALQTFSQLCYFDFTSKLIELISAPWRISDTPRFPYRGLLI
DTSRHYLPVTVIKKVIDTMAYSKLNVLHWHIVDAQSFPIEIPSYPKLWNGSYSFSERYTT
SDAVDIVRYAENRGVNVMAEIDVPGHALSWGVGYPSLWPSDSCKEPLDVSNNFTFGVIDG
ILSDFSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNQMNVSDAYRYFVLRSQKLAIS
HGYDVINWEETFNNFGDKLDRRTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDAT
WEGFYTNEPLKGIDDPEQQSLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEK
IAEDPRLVTSRLARFRCLLNQRGVAAAPVAGYGRTAPYEPGPCVRQ
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggcgcaggctctgagtttggggttgcttcttgcgtttctggcaattcaatcctgcatc
gccattgagctgactgatcacatcgacttgtggcctatgccaacgtcggtgagccatgga
acacaaagactttatgtcagcaaagatatcacaatgtcaatggagggaagcacgtatcct
gacgggaaagggatcttgaaggatgccttccagagggtagttgatttaatgaaactgaac
catgtcgttgatggtgcaaacccaagttcttttgtactcactggtgtaaatgtagttgtc
cattcacctgaagatgagctcaaattcggagtagatgaatcatataacttatctgttcct
acagcaggatatccattgcgcgtacagattgaggctcaaacagtatttggagcacttcat
gctttacagacatttagccaactgtgttacttcgatttcacatcaaaacttatagaactc
atctcggctccttggagaatttctgacacaccaagatttccttaccgaggacttcttatt
gatacctcaaggcactaccttcctgttacggtaattaaaaaagtgattgatacaatggcc
tacagtaaattgaacgttctccattggcatattgtggatgcacagtcatttcccattgaa
ataccttcataccctaaactgtggaacggttcatattctttttcagagagatatacgacg
tctgatgctgtagacattgtacgatatgctgaaaatcgaggtgtaaatgttatggctgag
attgatgttcctggtcatgctctgtcatggggcgttggctacccatcattgtggccatca
gatagctgcaaagaaccacttgatgtcagtaacaacttcacgtttggagttattgatgga
attctttcagattttagcaaagtttttaaattcaaatttgtgcatttaggaggtgatgaa
gtcaacacaagctgctggactgcaacaccccacattaagaaatggttggatgataaccaa
atgaatgtgtcagatgcatacagatattttgtgttgagatcccaaaagctagcaatatca
cacggttatgatgtcatcaactgggaggaaacatttaacaattttggagacaaattggac
cgtagaaccgtggttcataactggcttggagaggatgtagcaccaaaagtggttgcggca
gggctgagatgcatcgtaagcaaccaggataagtggtacctagatcacttagatgccaca
tgggaggggttttacacgaatgaacctctgaaaggtattgacgacccagagcagcaaagt
ttggtcattggtggtgaggtttgtatgtggggcgaacaaattgacgcatcggatattgaa
caaaccatttggccacgtgctgcagctgctgcagagagactatggactcctattgagaag
attgcagaagacccaagattggtcacgtcaagattggcacgcttcaggtgtttgctgaac
caaagaggggtagctgctgcaccggtggctgggtatggccgtacagcaccatatgaacct
ggtccctgtgtaaggcaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332084
Entry
4332084           CDS       T01015                                 
Name
(RefSeq) beta-hexosaminidase 2
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00513  Various types of N-glycan biosynthesis
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4332084
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4332084
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4332084
   00531 Glycosaminoglycan degradation
    4332084
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4332084
   00604 Glycosphingolipid biosynthesis - ganglio series
    4332084
   00511 Other glycan degradation
    4332084
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4332084
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4332084
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4332084
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4332084
NCBI-ProteinID: XP_015632008
UniProt: A0A8J8XVU2 Q10PW1
LinkDB
Position
3:complement(6280233..6282733)
AA seq 605 aa
MAALPAYLLLLLLILVILRPAAAPGAASQPPTSEPHLPPPLLAQKVQVWPKPTSISWPSA
VYAPLSPSFSVRAVLSHPSLRQAVAFYTRLIRAERHAPLVPPANYTLSRVPVRTLTLSVS
DPDVPLGPAVDESYTLSVLPDSGSADISAATPWGAIRGLETFSQLAWAGGGAASGGQPIV
PSGIEISDRPHFTHRGILLDTARNFYPVRDILHTLRAMAFNKLNVFHWHITDAQSFPIVL
PTVPNLANSGSYSPTMRYTENDVRHIVSFAASFGIRVIPEIDMPGHTGSWAGAYPEIVTC
ANRFWAPHAEPALAAEPGTGQLNPLNPKTYRVAQDVLRDMVALFPDPYLHGGADEVNTAC
WEDDPVVRRFLAEGGTHDHLLELFINATRPFVAQELNRTVVYWEDVLLGPKVTVGPTILP
RETTILQTWNDGPENTKRVVAAGYRAIVSSASYYYLDCGHGGWVGNDSRYDKQEKEREGT
PLFNDPGGTGGSWCAPFKTWQRVYDYDILHGLTDDEAQLVLGGEVALWSEQSDETVLDAR
LWPRAAAAAETLWSGNKGSNGKKRYANATDRLNDWRHRMVERGIRAEPIQPLWCSLHPGM
CNLSQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcggcattgccggcctatctcctcctcctcctcctcatcctggtgatcctccgacca
gcggctgcgcccggcgccgcttcgcagccgcctacctcggagcctcacctcccgccgccg
ctgcttgctcagaaggtgcaggtgtggcccaagccgacgtccatctcgtggccgtccgcg
gtgtacgcgccgctctcgccgtcgttcagcgtccgcgcggtgctgtcccacccgtcgctc
cgccaggcggtagccttctacacccgcctcatccgcgccgagcgccacgcgccgctggtt
ccccccgccaactacaccctctcccgcgtccccgtccgcaccctcacgctctccgtctcc
gaccccgacgtcccgctcggccccgccgtcgacgagtcctacacgctctccgtgctcccg
gactccggatcggccgatatctccgccgccacgccatggggcgccatccgcgggctcgag
accttctcccagctcgcctgggccggcggcggcgccgcctccggtggccagccgatcgtc
cccagcggcatcgagatctccgaccgcccacacttcacccaccgcggcatcctcctcgac
accgccaggaatttctacccggtccgcgacatcctccacaccctccgcgccatggccttc
aacaagctcaatgtcttccactggcacatcaccgacgcccagtccttccccatcgtcctc
cctaccgtccccaacctcgccaactccggctcctactcccccaccatgcgctacaccgag
aacgacgtccggcacatcgtcagcttcgccgcctccttcggcatccgcgtcatccccgag
atcgacatgcccgggcacacgggttcgtgggcgggagcgtacccggagatcgtcacctgc
gcgaacaggttctgggcgccgcacgcggagccggcgctggcggcggagcccggcacgggg
cagctgaacccgctcaaccccaagacgtaccgcgtggcgcaggacgtgctgcgcgacatg
gtggccctgttcccggacccgtacctccacggcggcgccgacgaggtgaacacggcgtgc
tgggaggacgacccggtggtgcgccggttcctcgccgagggcggcacgcacgaccacctc
ctggagctgttcatcaacgcgacgcgcccgttcgtggcgcaggagctgaaccgcacggtg
gtctactgggaggacgtcctcctcgggcccaaggtcaccgtcggccccacgattctgccc
agggagaccaccatactgcagacgtggaacgacgggccggagaacacgaagcgcgtcgtc
gccgcgggctaccgcgccatcgtgtcgtcggcgtcgtactactacctggactgcggccac
ggcgggtgggtgggcaacgacagccggtacgacaagcaggagaaggagcgcgagggcacg
ccgctgttcaacgaccccggcggcacgggcgggtcatggtgcgcgccgttcaagacgtgg
cagcgcgtctacgactacgacatcctgcacgggctgaccgacgacgaggcgcagctggtg
ctgggcggggaggtggcgctgtggtcggagcagtcggacgagacggtgctggacgccagg
ctgtggccgagggccgccgccgccgcggagacgctctggtccggcaacaagggctccaac
gggaagaagcgctacgcgaacgccaccgaccgcctcaacgactggaggcaccggatggtc
gagcgcggcatccgcgccgagcccatccagccgctctggtgctcgctccaccccggcatg
tgcaacctgtcgcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337620
Entry
4337620           CDS       T01015                                 
Name
(RefSeq) beta-hexosaminidase 1
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00513  Various types of N-glycan biosynthesis
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4337620
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4337620
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4337620
   00531 Glycosaminoglycan degradation
    4337620
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4337620
   00604 Glycosphingolipid biosynthesis - ganglio series
    4337620
   00511 Other glycan degradation
    4337620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4337620
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4337620
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4337620
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4337620
NCBI-ProteinID: XP_015640411
UniProt: Q5W7D7 Q65XA2
LinkDB
Position
5:complement(864036..870804)
AA seq 541 aa
MPPKLLTYLILALLAASAAAARRHPSPASSAAAGEPVYLWPLPRNFTSGSRTLLVDPDLA
LDGQGPGGAAAAVAEAFERYRSLVFSPWAHAARNASGGYDVGKLTVVVASADEKLELGVD
ESYTIYVAAAGGVNSIVGGATIEANTIYGAIRGLETFSQLCVFNYDTKNVEVRHAPWYIE
DEPRFAFRGLLLDTSRHFLPVDVIKQVIDSMSFSKLNVLHWHIIDEQSFPLEVPSYPKLW
KGSYSKLERYTVEDARDIVSYARKRGIHVMAEIDVPGHAESWGKGYPKLWPSPKCREPLD
VTSNFTFEVISGILSDMRKIFPFGLFHLGGDEVYTGCWNATPHVKQWLHERNMTTKDAYK
YFVLKAQEIAINLNWIPVNWEETFNSFKENLNPLTVVHNWLGPGVCPKVVEKGFRCIMSN
QGVWYLDHLDVPWQDFYTSEPLAGINNTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAA
AAAERMWSQLEAISAQDLETTVLARLHYFRCLLNHRGIAAAPVTNSYARRPPIGPGSCFI
Q
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgccccccaaactcctcacttatctcatcctagccctcctcgccgcctccgccgccgca
gcgcggcgccacccgtctccggcgagctcagccgccgccggggagcccgtctacctatgg
ccgctgccgaggaacttcacctcgggttcccggaccctgctggtcgaccctgacctcgcg
ctcgacggccagggccccggcggcgccgccgcggcggtggccgaggcgttcgagaggtac
agatcgctcgtcttctctccatgggcgcacgccgcgcgcaacgcctcgggtgggtacgac
gtcgggaagctcaccgtcgtcgtcgcctccgccgatgagaagctggagcttggagtggac
gagagctacacgatctatgtcgcggcggcgggcggcgtcaattcgatcgtgggtggagca
accatagaggctaacaccatatatggagctattcgtggattagagacattcagtcaattg
tgtgttttcaactacgataccaaaaatgtcgaagtgcgtcatgccccatggtacattgaa
gacgaaccacgctttgcttttcgtgggttgctccttgacacatcaaggcatttcctccca
gtagatgtgattaaacaagtgattgactccatgtcattttctaagctgaatgttcttcat
tggcatatcatcgacgagcaatcttttccattagaagtaccatcatatccaaaactatgg
aagggttcatattcaaaattggagcgctacactgtggaagatgcacgtgatattgtcagc
tatgctaggaaaagaggtatccatgtcatggctgaaattgacgtgcctggccatgcagaa
tcatggggaaagggatatccaaagctctggccttctcctaagtgcagagaaccgttagat
gttactagcaatttcacatttgaagttatttctggaattttgtctgatatgagaaaaatc
tttccatttgggctcttccacttgggtggtgatgaagtatatacaggttgctggaatgca
acaccccatgtgaaacagtggcttcatgaacgcaacatgactacaaaagatgcttacaaa
tacttcgtcctgaaggctcaagagatagcaattaaccttaattggattccagtaaattgg
gaagaaaccttcaactcattcaaagaaaatctcaatcctctaaccgtggtgcataactgg
ctgggtcctggagtctgccctaaagttgttgaaaagggtttcagatgtataatgagtaac
caaggtgtatggtaccttgatcatcttgatgttccctggcaagatttctacactagtgag
ccactcgctggaattaataacacagcacagcaaaagcttgtacttggtggagaggtttgc
atgtggggtgagacagcagacacctctgatgttcagcaaacgatatggccacgagcagct
gcagcagcagagcgtatgtggagtcagttagaggccatatctgcccaagacctggaaaca
accgtcttggctcggttacactatttcagatgcctgctgaatcaccgtggaatcgctgca
gctccagtcacaaactcttatgctcggcgtcccccaattggtcctggttcatgcttcatt
cagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338802
Entry
4338802           CDS       T01015                                 
Name
(RefSeq) beta-hexosaminidase 3
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00513  Various types of N-glycan biosynthesis
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4338802
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4338802
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4338802
   00531 Glycosaminoglycan degradation
    4338802
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4338802
   00604 Glycosphingolipid biosynthesis - ganglio series
    4338802
   00511 Other glycan degradation
    4338802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4338802
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4338802
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4338802
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4338802
NCBI-ProteinID: XP_015640653
UniProt: Q5WMR0 A0A0P0WMD4
LinkDB
Position
5:20315461..20320674
AA seq 531 aa
MAPAMALRLLVVVAVAAVVSCAVAADEGSVVEVWPMPATASKGGQTLHVSRELRMTAEGS
KYADGEAILKDAFQRMVTLIELDHVINGSSQGLPLLAGVNVVVHLPGDELNFGVDESYNL
SVPATGSPIYAQIEAQTVFGALHALETFSQLCNFDFTSRLIELQSAPWSITDMPRFPYRG
LLIDTSRHYLPVPVIKSVIDSMTYSKLNVLHWHIVDEQSFPIEIPSYPKLWNGAYSYSER
YTMDDAIDIVQYAERRGVNVLAEIDVPGHALSWGVGYPSLWPSATCKEPLDVSSESTFQV
INGILSDFSKVFKFKFVHLGGDEVNTSCWTSTPRVKAWLAQHGMKESDAYRYFVLRAQKI
AKSHGYEVINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHL
EVTWDGFYMNEPLRNIKNPAQQKLVLGGEVCMWAEHIDASDIQQTIWPRAAAAAERLWTP
FEKLSKEWEIAALSARLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSCIKQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcgccagcgatggctctgaggttgctggtggtggtggcggtggcggcggtggtgtcc
tgcgccgtcgccgccgatgaggggagcgtcgtcgaggtgtggccaatgccggcgacggcg
agcaaaggcgggcagacgctgcacgtcagcagggagctcaggatgacggcggaggggagc
aagtacgccgacggggaggccatcctgaaggacgcgttccagaggatggtgacgctgata
gagctggaccacgtcatcaatggcagctcccagggcttgccgctgctcgccggtgtgaat
gtcgtcgtgcatttgcccggcgatgagctcaacttcggggtggatgaatcatacaatttg
tcagtgcctgcaactggaagtccaatttatgctcaaattgaggcccaaacagtttttgga
gcacttcatgccttggagacgtttagccaattgtgtaactttgatttcacctcaaggtta
attgaacttcagtctgccccttggagcatcacggacatgcccagatttccttatcgaggg
cttcttattgatacttcaaggcattaccttcctgtcccagtaataaaaagcgtaatcgat
tcgatgacctacagcaagttgaatgttcttcattggcatatcgtggatgaacagtcattt
cctatagaaataccttcatacccaaaattatggaatggtgcatactcttactcagagaga
tatacaatggatgatgctatcgacattgttcagtatgctgaacgacgaggtgtcaatgtc
ttagctgagattgatgttcctggccatgctctctcatggggtgttggttatccgtcgttg
tggccatcagctacttgtaaagaaccacttgatgtcagcagcgaatctacattccaagtg
attaatggaattctttcagatttcagcaaggtttttaagttcaagtttgtccatttggga
ggtgatgaggtcaatacaagttgctggacttccacaccacgcgttaaagcatggttggcc
caacatggtatgaaagaatctgatgcctacagatattttgtattgagagctcaaaagata
gcaaaatcacatggctacgaagttattaactgggaagaaacctttaacaactttggagac
aaactagaccgcagaactgtggtgcataactggcttggaggtggagttgcagagaaagtt
gttgctgctggtttgagatgcattgtgagcaaccaggataagtggtacctagatcacttg
gaagttacatgggatggattttatatgaatgaaccactgagaaatatcaagaacccggca
cagcagaagttggttcttggtggtgaggtatgcatgtgggctgaacacatagatgcgtct
gacattcagcaaaccatttggccacgtgctgcagcagctgcagagcggttgtggactccg
tttgagaagctttcaaaggagtgggaaatagcagcgctcagcgcaagactggcacgcttc
aggtgcttgctgaatcatagagggatcgctgctggaccggtaactggttatggacgttcc
gcgccagcagagccaagctcctgtataaagcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343697
Entry
4343697           CDS       T01015                                 
Name
(RefSeq) beta-hexosaminidase 2
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00513  Various types of N-glycan biosynthesis
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4343697
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4343697
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    4343697
   00531 Glycosaminoglycan degradation
    4343697
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4343697
   00604 Glycosphingolipid biosynthesis - ganglio series
    4343697
   00511 Other glycan degradation
    4343697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4343697
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4343697
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4343697
SSDB
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4343697
NCBI-ProteinID: XP_015645456
UniProt: A0A0P0X7V8
LinkDB
Position
7:complement(23274101..23276916)
AA seq 611 aa
MSTNQGVQLRLAAQAKAAMATKNGGFVALLLLLSFLLSSPLPARCDAPLPVNVWPKPTSM
SWAEPHMAVRVSSSFHVVAPSGNAHLLSAARRYAALLLAERYRPLVTPAVNVTAGGAGAG
AAGRGAELGYLTLAVSDLHAPLQHGVDESYALEILPAGAAATVTAATAWGAMRGLETFSQ
LAWWCGRERAVLVAAGVRVEDRPLYPHRGLMLDTGRTYFPVADILRTIDAMAANKMNVFH
WHITDSQSFPLELPSEPALAEKGSYGDGMRYTVDDVKLIVDFAMNRGVRVVPEIDTPGHT
ASWAGAYPELVSCAGEFWLPDASDWPSRLAAEPGAGQLNPLEPKTYQVMSNVINDVTSLF
PDGFYHAGADEVTPGCWNADPSIQRYLARGGTLSRLLEKFVGAAHPLIVSRNRTAVYWED
VLLDQAVNVTASAIPPETTILQTWNNGGNNTRLIVRAGYRAIVSSASFYYLDCGHGDFAG
NDSAYDDPRSDYGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDA
AVLDGRVWPRASAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWC
RNRPGMCNLVR
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtccaccaatcagggggtgcagctccgattagcggctcaagctaaggcagccatggca
accaagaacggtggttttgttgcgttgctgctgctgctgtcgttcttgctgagctcgccg
ctgccggcgcgatgcgacgcgccgctccccgtcaatgtctggcccaagccgacgtccatg
tcgtgggcggagccccacatggccgtgcgtgtctcgagctcgttccacgtcgtcgccccg
tccgggaacgcgcacctcctctcggcggcgcggcgctacgccgcgctgctcctcgccgag
cggtaccggcccctcgtgacgccggcggtgaacgtcaccgcgggcggcgccggcgccggc
gcggcgggaaggggagccgagctggggtacctgacgctcgccgtgtccgacctgcacgcg
ccgctgcagcacggcgtggacgagtcgtacgcgctggagatcctccccgccggcgcggcg
gccacggtgaccgcggccacggcgtggggcgccatgcgcggcctcgagacgttctcgcag
ctggcgtggtggtgcgggcgggagcgggcggtgctggtggccgccggcgtgcgcgtcgag
gaccggccgctgtacccgcaccgcgggctgatgctggacaccgggaggacgtacttcccc
gtcgccgacatcctccggacgatcgacgccatggcggcgaacaagatgaacgtgttccac
tggcacatcacggactcccagtcgttccccctcgagctcccctccgagccggcgctcgcc
gagaagggctcctacggcgacggcatgcgctacaccgtcgacgacgttaagctcattgtc
gacttcgccatgaaccgcggcgtccgcgtcgtgccagagatagacacacccggccacacg
gcgtcgtgggccggagcttaccccgagctggtgtcctgcgccggcgagttctggctgccc
gacgcgtctgactggcccagccgacttgccgccgagccgggcgccggccagctcaacccg
ctggagcccaagacgtaccaggtgatgtccaacgtcatcaacgacgtcacctccctcttc
ccggacggcttctaccacgccggcgccgacgaggtcacgccggggtgctggaacgccgac
ccgtccatccagcgctacctcgcccgcggcggcacgctcagccgcctcctcgagaagttc
gtcggcgcggcgcacccgctgatcgtgtcccggaaccggacggcggtgtactgggaggac
gtgctgctggaccaggcggtgaacgtgaccgcgtcggcgatcccgccggagacgacgatc
ctgcagacgtggaacaacggcggcaacaacacgaggctgatcgtgcgcgccgggtaccgg
gccatcgtctcgtcggcgtcgttctactacctcgactgcggccacggcgacttcgccggc
aacgactccgcctacgacgacccgaggagcgactacggcaccagcggcgggtcgtggtgc
ggaccgtacaagacgtggcagcgggtgtacgactacgacgtcgcgggcgggctcaccgcc
gaggaggccaggctggtggtcggcggggaggtggcgatgtggacggagcaggtggacgcg
gcggtgctcgacggcagggtgtggccgagggcgtcggcgatggcggaggcgctgtggtcg
ggcaaccgcgacgccaccggccggaagcgctacgccgaggcgaccgaccggctcaccgac
tggcggcaccggatggtggggcgaggggtccgcgcggagcccatccagccgctctggtgc
aggaaccgcccgggaatgtgtaacttggtccggtga

DBGET integrated database retrieval system