KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324917
Entry
4324917           CDS       T01015                                 
Name
(RefSeq) putative exosome complex component rrp40
  KO
K03681  exosome complex component RRP40
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4324917
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4324917
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4324917
SSDB
Motif
Pfam: KH_6 Rrp40_N
Other DBs
NCBI-GeneID: 4324917
NCBI-ProteinID: XP_015621111
UniProt: Q5JLX2 A0A8J8XN08
LinkDB
Position
1:complement(38754957..38759549)
AA seq 239 aa
MESRKPPPSALVDNHVVPGDVVLDLTEMTNQTIKLGAGLRQDCDTIQATSAGRLRLSKPN
KYWVESSQKRYIPSVEDTVLGVVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDATGKAAEFGQLKDGYMFDTSTGLSRMLLSSPTCPVL
EALGKKLSFEIAVGLNGRVWVNAPSPSNVIVVSNAIIKSESLSGIGQRSMVESLLERLS
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaatcgaggaagccgccaccctctgccctcgttgacaaccacgtggtccccggagac
gtcgtcctcgacctcaccgagatgaccaaccagaccatcaagctcggcgctggcctgcga
caggattgcgacaccatacaggctaccagtgctgggaggctacggctttcgaagcccaac
aaatattgggtcgagagctcgcagaagaggtatataccttctgtagaagatacagttctt
ggtgttgtggttgacaccaaaccagataacttcttggtggatataaaaggtcctaatttg
gcctttttaccagttcttgcatttgaaggtggtaccaggagaaatattccaaagttcgag
attggtacattaatatatgcacgagtggtgaaagcaaatagcatcatgaacccagagctc
tcgtgcatggatgctactgggaaagcagccgaatttggtcaactaaaagatggctatatg
tttgacacgtctactggcttgtcgcggatgttgttaagttctccaacatgtccagttcta
gaggcccttggaaaaaaactttcatttgagattgctgttggcctgaatggccgagtctgg
gttaatgcaccttctccaagtaatgtcattgttgtatcaaatgcgattataaaatcagaa
tctttgagtggcatagggcaacgaagtatggtggaaagtctcttggagagactatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327851
Entry
4327851           CDS       T01015                                 
Name
(RefSeq) putative exosome complex component rrp40
  KO
K03681  exosome complex component RRP40
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4327851
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327851
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4327851
SSDB
Motif
Pfam: KH_6 Rrp40_N
Other DBs
NCBI-GeneID: 4327851
NCBI-ProteinID: XP_015621208
UniProt: Q0JKN6 A0A0P0V6C1
LinkDB
Position
1:27004246..27008039
AA seq 239 aa
MESRKPPPSALVDNHVVPGDVVLDLAEMTNQTIKLGAGLRQDCDTIQATSAGRLRLSKPS
KYWVESSQKRYIPSVEDTVLGVVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDATGKAAEFGQLKDGYMFDTSTGLSRMLLSSPTCPIL
EALGKKLSFEIAVGLNGRVWVNAPSPSNVIVVSNAIIKSESLSGIGQRSMVESLLERLS
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaatcgaggaagccgccgccctccgccctcgtcgacaaccacgtggtccccggggac
gtcgtcctcgacctcgccgagatgaccaaccagaccatcaagctcggcgccggcctgcga
caggattgcgacaccatacaggctaccagtgctgggaggctacggctttcgaagcccagc
aaatactgggtcgagagctcgcagaagaggtatataccttctgtagaagatacagttctt
ggtgttgtggttgacaccaaaccagataacttcttggtggatataaaaggtcctaatttg
gcctttttaccagttcttgcatttgaaggtggtaccaggagaaatattccaaagttcgag
attggtacattaatatatgcacgagtggtgaaagcaaatagcatcatgaacccagagctc
tcgtgcatggatgctactgggaaagcagccgaatttggtcaactaaaagatggctatatg
tttgacacgtctactggcctgtcgcggatgttgttaagttctccaacatgtccaattcta
gaggcccttggaaaaaaactttcatttgagattgctgttggcctgaatggccgagtgtgg
gttaatgcaccttctccaagtaatgtcattgttgtatcaaatgcgattataaaatcagaa
tctttgagtggcatagggcaacgaagtatggtggaaagtctcttggagagactatcttga

DBGET integrated database retrieval system