KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324941
Entry
4324941           CDS       T01015                                 
Name
(RefSeq) bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
  KO
K15849  bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase [EC:2.6.1.1 2.6.1.78 2.6.1.79]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4324941
   00360 Phenylalanine metabolism
    4324941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4324941
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4324941
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4324941
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4324941
    2.6.1.78  aspartate---prephenate aminotransferase
     4324941
    2.6.1.79  glutamate---prephenate aminotransferase
     4324941
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 OKR_DC_1 Asp_aminotransf
Other DBs
NCBI-GeneID: 4324941
NCBI-ProteinID: XP_015641332
UniProt: Q5N9Z8 A3A017
LinkDB
Position
1:37779495..37782865
AA seq 458 aa
MAASTSATSFSTPTKPASSSSSSSSPNSVCFARASGRCRMASVVVRAEAVDATISPTVSA
LRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPHVIAEAGMNAIKDGYTRYTPNAGT
LELRKAICNKLQEENGISYSPDQVLVSNGAKQCITQAVLAVCSPGDEVLIPAPYWVSYPE
MATLAGATPVILPTSISENFLLRPELLASKINEKSRLLILCSPSNPTGSVYPKELLEEIA
DIVKKYPRLLVLSDEIYEHIIYQPAKHTSFASLPGMWDRTLTVNGFSKAFAMTGWRLGYL
AAPKHFVAACGKIQSQFTSGASSISQKAGLAALNLGYAGGEAVSTMVKAFQERRDYLVKS
FKELPGVKISEPQGAFYLFIDFSSYYGSEVEGFGTIKDSESLCMFLLEKAQVALVPGDAF
GDDKCIRMSYAAALSTLQTAMEKIKEAVALIKPRVAAK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcggcctccacctccgccacctccttctccactcccaccaagcccgcctcctcctcc
tcctcctcctcaagtcccaactccgtctgcttcgccagggcgtcggggaggtgcaggatg
gcgtcggtggtggtgagggcggaggcggtggacgcgaccatcagcccgacggtgagcgcg
ctgcggccgtccaagaccatggccatcaccgaccaggccacggcgctgcggcaggctggc
gtcccggtcatcggcctcgccgccggggagcccgacttcgacacgccgcacgtgattgct
gaggctgggatgaatgcaattaaggatggttatacaaggtacactcctaatgctgggact
ttggagctgagaaaggctatctgcaataaactccaagaggaaaatgggatatcctacagt
ccagatcaggtgctggtgagcaatggagctaagcaatgcattacgcaagccgtacttgcc
gtttgctcacctggtgatgaggttttgataccagcaccatactgggtcagttatcctgag
atggctacattggctggtgcaactccagtgatccttcctacaagcatatcagagaatttc
ttgctaaggccagagctgcttgcttcaaagatcaacgagaaatcgaggcttttgattctc
tgctctccttctaatccaactggatcagtatatccaaaggagctgcttgaagaaatagct
gacatagtcaagaagtatcctaggcttcttgttttgtctgatgagatttatgagcatatc
atctatcagccagcaaaacacacaagctttgcttcattgcctggaatgtgggatagaaca
ttaactgtaaatggtttttctaaggcttttgcaatgacgggctggcgacttggatacctt
gcagccccaaaacattttgttgcagcctgtggaaagatccaaagccagtttacttcaggt
gctagtagcatatcacagaaggcagggctcgctgctttgaaccttggctacgctggtggt
gaagcagtctcaactatggtcaaagcattccaggaacgtcgtgattaccttgtaaaaagt
ttcaaggaactgccaggtgtgaagatatcagagcctcagggtgccttttatttgttcatc
gacttcagctcctactatggatctgaagtagagggttttggcactatcaaggactctgag
tccctctgcatgttcctcttggagaaagcacaggttgcacttgtcccgggcgatgcattt
ggggacgacaaatgcatccgcatgtcatatgctgcagcactatctacgcttcaaactgct
atggagaaaatcaaagaagctgttgcgctgatcaaaccccgtgttgctgctaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325621
Entry
4325621           CDS       T01015                                 
Name
(RefSeq) aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00710  Carbon fixation in photosynthetic organisms
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325621
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4325621
   00270 Cysteine and methionine metabolism
    4325621
   00220 Arginine biosynthesis
    4325621
   00330 Arginine and proline metabolism
    4325621
   00350 Tyrosine metabolism
    4325621
   00360 Phenylalanine metabolism
    4325621
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4325621
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4325621
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4325621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4325621
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325621
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325621
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4325621
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4325621
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4325621
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4325621
  Exosomal proteins of other body fluids (saliva and urine)
   4325621
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4325621
NCBI-ProteinID: XP_015621160
UniProt: P37833 Q0JJ47 A0A0P0V8J5
LinkDB
Position
1:complement(31998727..32003685)
AA seq 460 aa
MPSANVRGAQPSADRRLSTLVRHLLPSSARTATTTSTSSSAADADSSLQAFPTMASSSVF
AGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINNPSR
VKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHER
TIYIPQPTWGNHPKVFTLAGLTVRSYRYYDPATRGLDFQGLLEDLGSAPSGAIVLLHACA
HNPTGVDPTLDQWEQIRQLMRSKALLPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLM
AQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPPIHGASIVATILKD
SAMFNEWTVELKGMADRIISMRQQLFDALKTRETPGDWSHIIKQIGMFTFTGLNSDQVAF
MRQEYHIYMTSDGRISMAGLSGRTIPHLADAIHAAVTKLK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgccatccgctaacgtgcgcggggcgcagcctagcgccgaccgcaggttaagtacgctg
gtgcgccacctactgccttcctccgcacgaacagcaaccaccaccagcacctcctcctcc
gccgccgacgccgactcctccctccaagctttccccaccatggcgtcgtcgtccgtcttc
gctggcctcgcgcaggcgccggaggaccccatcctcggggtgacggtcgcgtacaacaag
gatcccagccccgtgaaggtcaatctcggcgtcggcgcctaccggaccgaggaagggaag
cccctggtgctgaatgtggtcaggcgcgctgagcagatgctgatcaacaacccgtcacgt
gttaaggagtatttgccgatcactggactggccgatttcaataagctgagtgctaagctt
atttttggtgctgacagtcctgccattcaagagaatagggtggctacagttcagtgcttg
tcaggaactggttctttaagggtgggaggtgaatttcttgcaaggcattatcatgaacgc
actatatacatcccacagccaacctgggggaatcaccccaaagtgttcactttagctggc
ctgactgttaggagttaccgctactatgatcctgcaacccgtggactggatttccaaggg
ctgttagaagatctcggttcagctccttcaggtgcaattgtactgcttcatgcttgtgcc
cacaaccctactggagtagacccaactttggaccagtgggaacagatcaggcagttgatg
agatcaaaagcattgctgccattctttgatagcgcttatcagggatttgcaagtggaagt
cttgaccaagatgctcaatcagtgcgcatgtttgttgctgatggtggtgaattgctcatg
gctcagagctacgctaagaacatgggattgtatggagagcgtgtcggtgctttaagcata
gtttgtggaagtgctgatgtagctgtcagggttgaaagtcaacttaagcttgtaattagg
cctatgtattcaaaccctcctattcatggtgcatctatcgtggctaccatacttaaggac
agtgcaatgttcaatgaatggactgtggagctgaagggcatggctgataggattattagc
atgaggcaacagctttttgatgctctgaaaacgagagaaactcctggagactggagtcac
atcattaagcagatcggaatgttcactttcactgggctcaacagtgatcaagtggctttc
atgaggcaggaataccacatttacatgacatctgatgggaggatcagtatggctggtttg
agcgggaggaccattccgcatcttgcagatgcaatccatgccgcagtcacaaaactgaag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328828
Entry
4328828           CDS       T01015                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial isoform X1
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00710  Carbon fixation in photosynthetic organisms
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328828
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4328828
   00270 Cysteine and methionine metabolism
    4328828
   00220 Arginine biosynthesis
    4328828
   00330 Arginine and proline metabolism
    4328828
   00350 Tyrosine metabolism
    4328828
   00360 Phenylalanine metabolism
    4328828
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4328828
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4328828
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4328828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4328828
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4328828
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4328828
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4328828
NCBI-ProteinID: XP_015626224
LinkDB
Position
2:7706616..7710908
AA seq 438 aa
MAMSSSRSAAAIRGRRVGALARARRHATRAMASLFGHVEPASKDPILGVTEAFLADPSPD
KVNVGVGAYRDDNGKPVVLECVREAERRIAGNLNMEYLPMGGSIKMIEESLKLAYGEDSD
FIKDKRIAAVQALSGTGACRLFADFQRRFLPNSQIYIPTPTWSNVCNFSSHHNIWRDAQV
PQRTFTYYHPESRGLDFAGLMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWREISYQFK
IKNHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSIL
CEDEMQAVSVKSQLQQIARPMYSNPPVHGALVVSIILNDPELKSLWLKEVKGMADRIIGM
RKALRENLEGLGSPLSWDHITNQIGMFCYSGMTPEQVDRLTNEYHIYMTRNGRISMAGVT
TGNVAYLANAIHEVTKTK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcgatgtcgtcgtcccgctcggcggccgcgatccgggggcggcgggtcggggcgctg
gcgagggcgaggaggcacgcgacgagggcgatggcgtcgctgttcggccacgtcgagccg
gcttccaaggaccccatcctcggcgtcaccgaggccttcctcgccgacccctcccccgac
aaagtcaacgtcggcgtcggcgcctaccgggacgacaacggcaagcccgtcgtgctcgag
tgcgtgcgcgaggccgagcgccggatcgccggcaacctcaacatggagtaccttccaatg
ggaggaagtataaagatgattgaagagtcactaaagctggcatatggtgaggattctgat
ttcatcaaagataagaggattgctgcggtgcaggctctttcaggcacaggtgcatgccgg
ctctttgccgatttccagaggcgtttcttgccaaattcacagatctacatacctacacct
acatggtccaatgtgtgtaacttctccagtcatcataacatttggagggatgctcaagta
cctcaaaggacattcacctattaccatccagagtcaagagggcttgatttcgcaggactg
atggatgatattaagaacgctccaaatggttcattctttttgcttcatgcttgtgcccat
aatcctactggagttgatcctacagaagaacaatggagagagatatcctaccaattcaag
ataaagaatcatttcccattctttgacatggcataccaaggatttgccagcggtgatcca
gagagagatgctaaggcaatccgaatcttccttgaagatgggcatcaaattggatgtgct
cagtcatatgcaaagaacatgggactgtatgggcaaagggcagggtgcttgagtattctg
tgtgaggatgagatgcaagcagtttctgttaagagccaattgcaacagattgcaaggcca
atgtacagcaacccacctgttcatggtgcactggttgtctccataatccttaatgatcca
gaattaaagagtttatggttgaaagaggtcaagggtatggctgatcgaatcattggaatg
cggaaggcactccgggaaaatctcgaaggcctaggttcaccattgtcatgggatcacatc
accaatcagattggaatgttctgctacagtgggatgacacctgaacaggtggatcgctta
accaatgaataccatatttacatgacccgtaatggcagaataagcatggctggtgtaaca
acaggaaatgtggcgtatttggctaatgctattcatgaggtcactaaaacgaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331017
Entry
4331017           CDS       T01015                                 
Name
(RefSeq) aspartate aminotransferase, chloroplastic
  KO
K00811  aspartate aminotransferase, chloroplastic [EC:2.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4331017
   00270 Cysteine and methionine metabolism
    4331017
   00220 Arginine biosynthesis
    4331017
   00330 Arginine and proline metabolism
    4331017
   00350 Tyrosine metabolism
    4331017
   00360 Phenylalanine metabolism
    4331017
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4331017
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4331017
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4331017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4331017
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4331017
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4331017
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4331017
NCBI-ProteinID: XP_015627319
UniProt: B9F416 Q6KAJ2
LinkDB
Position
2:33942024..33946395
AA seq 458 aa
MASAPFAVSSSPAASAVAARSKVLRGGRSEARTGCRLGITRKNFGRVMMALAVDVSRFEG
VPMAPPDPILGVSEAFKADQNDLKLNLGVGAYRTEELQPYVLNVVKKAETLMLEKGENKE
YLPIEGLAAFNKATAELLFGADNPVLKQGRVATLQSLSGTGSLRLAAAFIQRYFPEAKVL
ISSPTWGNHKNIFNDAKVPWSEYRYYDPKTVGLDFEGMIADIQAAPDGSFVLLHGCAHNP
TGIDPTPEQWEKIADVIQEKKHMPFFDVAYQGFASGSLDEDASSVRLFVQRGLEVFVAQS
YSKNLGLYAERIGAINVVCSTPEVANRVKSQLKRLARPMYSNPPIHGARIVANVVGDPTM
FGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMT
DKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcttccgcccccttcgccgtctcctcctcaccggcggcttccgccgtggccgcgcgc
tccaaggtgttgcgaggagggaggagcgaggcgaggactggatgccgcctggggatcacg
aggaagaattttggacgtgtcatgatggcccttgcagtagatgtctctcgttttgaagga
gtgccgatggcccctccagacccaattctcggggtttcagaagcatttaaggcagatcaa
aatgatctgaagctcaaccttggtgttggtgcctatagaacagaagagttacagccttat
gtcctcaatgtggtcaagaaggctgaaactcttatgttggagaaaggagaaaacaaggag
tatctgccaattgaaggcttagctgcatttaacaaagcaactgcagaactattgtttgga
gctgataatccagtactcaagcaaggacgtgttgctactcttcagtctctctcaggaacc
gggtcgctgcgccttgctgcagcatttatacaaagatatttccctgaagcaaaagtactg
atatcatctcccacttggggcaatcacaagaacattttcaatgatgcaaaggtaccttgg
tcagagtaccgttattacgaccccaagactgttggcttggattttgagggaatgatagct
gacatacaggctgccccagatggatcttttgttctgctgcatggttgcgctcacaaccca
actggaatagacccaactccggaacaatgggagaaaattgcagatgtcattcaagagaag
aaacacatgcctttctttgatgttgcatatcagggttttgccagtggaagccttgatgaa
gatgcatcttctgtcaggctttttgttcaacggggactggaagtgtttgttgcgcagtct
tatagcaaaaaccttggtttatatgcagaaagaattggagcaataaatgttgtctgctca
acacctgaagtcgcaaacagggtgaagagccagctgaaacgattggcacggcccatgtat
tcgaatccccctattcatggtgctaggatagttgccaacgttgttggggatccaaccatg
tttggtgaatggaaacaggagatggaagaaatggcagggcgtatcaagaatgtaagacag
aagctttatgatagtttgtctgcaaaggacgacagtggcaaggactggtctttcattctg
aggcagataggcatgttctcctacacgggcttgaacaaaactcagagtgataatatgacc
gacaaatggcacatatacatgacaaaggatgggagaatttcgttggctggattgtccctg
gctaaatgcgagtacctagctgacgccatcatcgactccttccataacgttagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341252
Entry
4341252           CDS       T01015                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00710  Carbon fixation in photosynthetic organisms
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4341252
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4341252
   00270 Cysteine and methionine metabolism
    4341252
   00220 Arginine biosynthesis
    4341252
   00330 Arginine and proline metabolism
    4341252
   00350 Tyrosine metabolism
    4341252
   00360 Phenylalanine metabolism
    4341252
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4341252
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4341252
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4341252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4341252
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4341252
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4341252
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4341252
NCBI-ProteinID: XP_015640924
UniProt: Q0DBN4 A0A0P0WXM3
LinkDB
Position
6:complement(20727268..20731780)
AA seq 463 aa
MHTRSRRLGFPPLNPSHLLLTPHLPPLSSDRARMAMSRAAAAAAGTPVARRRLMGAVAAR
SMASWFGHVEPAAKDPILGVTEAFLADPSPDKVNVGVGAYRDDSGKPVVLECVREAERRI
AGSMNMEYLPMGGSIKMIEESLKLAYGENCEFIKDKRIAAVQALSGTGACRLFADFQKRF
LPDSQIYIPTPTWANHHNIWRDAQVPQKTFTYYHPESRGLDFAGLMDDIKNAPDGSFFLL
HACAHNPTGVDPSEEQWREISHQFKVKKHFPFFDMAYQGFASGDPERDAKAIRIFLEDGH
QIGCAQSYAKNMGLYGQRAGCLSILCDDEMQAVAVKSQLQQIARPLYSNPPVHGALIVST
ILGDPELKSLWLKEVKGMADRIIGMRTALKENLEKLGSPMSWEHITNQIGMFCYSGMTPE
QVDRLTKEFHIYMTRNGRISMAGVTTGNVAYLANAIHEVTKTK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgcacacacgcagccgtcggcttggtttcccccccctgaatccaagtcacctcctcctc
acacctcaccttccccctctctcctccgatcgcgcgcgcatggcgatgtcacgagccgcc
gccgctgccgcggggactcccgtggcgcggcggcgattgatgggggccgtggcggcgagg
tcgatggcgtcgtggttcggccacgtggaaccggccgccaaggaccccatcctcggcgtc
accgaggcgttcctcgccgacccctccccggacaaagtcaacgtcggcgtcggcgcgtac
cgggacgacagcgggaagcccgtggtgctggagtgcgtgcgcgaggcggagcggcggatc
gccgggagcatgaacatggagtaccttccaatgggtggaagcataaagatgattgaagaa
tcacttaaactggcctatggggagaactgtgagttcatcaaggacaagaggatcgcagca
gtgcaggctctttcaggaactggtgcatgtcgcctctttgcagatttccagaagcgtttc
ttgccagattcacagatttatatacccacacctacatgggccaaccatcacaatatttgg
agggatgcccaagtaccacaaaagacatttacctattaccatccagagtcaagaggactt
gactttgcaggcctaatggatgatatcaagaatgctccagatggttcattctttttgctt
catgcttgtgcgcataatcccactggagtagatccttcagaagaacaatggagggagata
tctcatcagttcaaggtgaagaaacattttccattcttcgacatggcataccaaggattt
gctagtggtgatccagagagagatgccaaggcaattcgaatatttcttgaagatggacat
caaattggatgtgcacagtcatatgcgaaaaacatgggactttatggacaaagagcagga
tgccttagtattctatgtgatgatgagatgcaagcagttgctgttaagagccagttacaa
cagattgctagacctttgtacagcaacccacccgttcatggtgcattaattgtttcaact
attcttggtgatccggagttgaaaagtttatggctgaaagaggtcaagggtatggctgat
cgtatcattggaatgcgaacagcactcaaagagaaccttgaaaagttgggttcaccaatg
tcatgggaacatatcactaatcagattggaatgttctgctacagtggtatgacacctgaa
caagtcgatcgcttgacaaaagagttccatatctacatgactcgtaacgggcggataagc
atggctggagtaacaacaggaaatgttgcctatctggctaatgctattcatgaggttacc
aagacaaagtga

DBGET integrated database retrieval system