KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324952
Entry
4324952           CDS       T01015                                 
Name
(RefSeq) 5'-3' exoribonuclease 3 isoform X1
  KO
K12619  5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4324952
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4324952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4324952
   03019 Messenger RNA biogenesis [BR:osa03019]
    4324952
   03009 Ribosome biogenesis [BR:osa03009]
    4324952
   03016 Transfer RNA biogenesis [BR:osa03016]
    4324952
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     4324952
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     4324952
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     4324952
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    4324952
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    4324952
SSDB
Motif
Pfam: XRN_M XRN_N zf-CCHC
Other DBs
NCBI-GeneID: 4324952
NCBI-ProteinID: XP_015621120
UniProt: Q5N739 A0A0P0VB47
LinkDB
Position
1:complement(37844992..37852790)
AA seq 1068 aa
MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH
PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQQRSRRFR
AAKDAADAAAEEERLREEFEREGRKLPPKQQSQTCDSNVITPGTEFMAVLSIALQYYIHL
RLNYDPGWKQVKVILSDANVPGEGEHKIMSYIRGQRNLPGFNPNTRHCLYGLDADLIMLA
LATHEVHFSILREVVYTPGQQDKCFLCGQVGHLAANCEGKVKRKAGEFDEKGEAIVPKKP
YQFLNIWTLREYLEYEFRMQNPPFPIDFERIVDDFIFMCFFVGNDFLPHMPTLEIREGAI
NLLMAVYKKEFPSMGGYLTDACTPDLNKVEHFIQAVGSYEDKIFQKRARLHQRQAERIKR
EKAQAKRGDDLDPHVRDDLIVPVARFQGSRLASGPVPSPYEQNGSDKNNGGKNSRARKAA
RVSSSGSSIAAAIVEAENDLEAQERENKEDLKTMLKDALREKSDVFNSENPEEDKIKLGE
PGWRERYYEEKFGARTPGQIEEIRRDVVLKYTEGLCWVMHYYYEGVCSWQWFYPYHYAPF
ASDLSGLGQLNITFELGSPFKPFDQLMGVFPAASSHALPVQYRQLMTDANSPIIDFYPTD
FEVDMNGKRYSWQGIAKLPFIDEARLLAEIKKVEHTLTPEEARRNSIMFNMLFVNGSHPL
SPYIYSLNSKFGHLPDRERNEIKEKIDPSSSGGMNGYISLCSGDPCPPVFRSPVDGLEDI
MDNQVICTIYKLPDSHKHIARPPVGVIIPKKTVEATDLKPPPVLWHEDSGRRPHDNNNRR
PYENSNRQNPAGAISGRQLGEAAHRLVVNSLNARSGGQYNTPSMPYQTIMNGMPYPNGIP
PRMEQPAPGWHVPGDLPNGQVPPAYASSSGHYQNDRSGPSQYGRDNHGRYPYARDNHHDS
RGRVPPYHQSGGNSYQSHSAPSAGPGRYAQPPPYAGGYGRSYQPAPYGGGQQWQQQQQQP
YGSYAGSGPYGGGAPPARPNSRPQQSQNRYNTLDRNSNRRPPPGHGRH
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgggtgtgccggcgttctaccggtggctggcggagaagtacccgatggtggtggtggac
gtggtggaggaggaggcggtggagatcgagggcgtcaaggtgcccgtcgacacctccaag
cccaaccccaacggcctcgagttcgacaacctctacctcgacatgaacgggatcattcac
ccctgcttccaccccgaggataggccctctccgacaacattcgctgaggttttccagtgc
atgtttgattatatcgataggctatttgtcatggttcgccctcggaagcttatgtatatg
gccattgatggtgttgctcctcgtgccaagatgaaccagcaacgctctagacgattcaga
gctgcaaaagatgctgctgatgcggccgcagaagaagagaggttgcgtgaagagtttgag
agggaaggcagaaaacttccaccaaaacagcaatctcaaacatgtgattctaacgttatt
actccaggaacagagtttatggctgttttatcgattgctttgcagtactacatccatctc
aggttgaattatgatcctggatggaaacaagttaaagttattctttctgatgccaatgtt
cctggtgaaggggaacataaaattatgtcctacattcgcggtcaacggaatctccctgga
tttaacccaaatactcgccattgtttgtatggcctggatgcagacctgatcatgttagct
cttgcaacacacgaagtacatttctctatactgagagaggtagtttatacacctggacag
caggacaaatgcttcttgtgtggtcaggttggacatctagcagcaaactgtgaaggaaag
gttaagagaaaagctggggagtttgatgaaaaaggtgaagctattgttccaaagaaacct
taccagttcttgaatatatggaccctccgggagtacttagaatatgagttcagaatgcag
aatccacctttcccgattgactttgaacgcatcgttgatgatttcatcttcatgtgtttt
tttgttggcaatgattttcttccacatatgccaacattagagattcgtgagggagctatt
aacttgctaatggctgtatacaagaaggaatttccttccatgggtggctatctaactgat
gcttgcacgccggatctgaataaagttgaacactttattcaagcagttggctcctacgag
gataaaatatttcagaaaagagctcgtttgcatcagcgtcaagctgaaaggataaaacga
gaaaaggcccaagcaaaacgaggggatgacctggatccccatgtcagggatgatcttatt
gtacctgttgcacgcttccaagggtctcgccttgcatctggacctgtgccttcaccatat
gaacaaaatggatctgacaaaaacaatgggggaaaaaatagtcgtgctcggaaagctgca
cgggtatcatcgtcaggttcaagcattgcggctgctattgttgaagctgaaaatgacctt
gaagcacaggaacgcgaaaacaaggaagatttgaagacaatgcttaaagatgcacttcgt
gagaaatctgatgtttttaattctgaaaatccagaggaggacaagataaaacttggagaa
ccaggatggagggaaaggtactatgaagagaagtttggagcaagaacacccgggcagatt
gaagaaatacgcagagatgtcgttctgaaatatactgaaggtttgtgttgggtaatgcac
tactattatgaaggtgtctgctcgtggcaatggttttacccttaccattatgctcctttt
gcttcggatttgagtggtctaggtcaactcaatataacttttgaacttgggtcaccattc
aaaccgtttgatcaacttatgggagttttcccagctgctagctcccatgcactccctgta
cagtatcggcaattgatgacagatgcaaattcaccaataattgatttttatccaactgat
tttgaagtagatatgaatgggaagaggtattcatggcaggggatagcaaaactgcccttc
attgatgaagcccggttgctagctgaaattaaaaaagttgagcatactttgacgcctgaa
gaagcaaggagaaacagtatcatgttcaatatgctttttgtgaatggctcccatccactt
tcgccttatatctactccctcaacagcaaatttggacacctacctgacagagagcgaaat
gaaattaaagaaaagattgatccttcttctagtggaggaatgaatggttacatctcactt
tgtagtggggatccgtgccctcctgtcttcaggtctcctgttgatgggttggaggatatc
atggacaatcaagtgatatgtacaatctacaagcttccggattctcataagcacatcgct
cgtccacctgttggtgtaatcatacccaagaagactgttgaagctactgacctgaaacca
ccacctgtgctatggcatgaagacagtggtaggaggcctcatgataataacaacaggagg
ccttatgaaaacagcaacaggcaaaacccagctggagcaatatctggccgccaacttggg
gaagctgcccaccgacttgtggtgaacagcttgaatgctcggagtggcggacaatacaat
accccatcgatgccatatcaaaccataatgaatggcatgccttatccaaatgggattcca
ccaaggatggagcagcctgctcctggctggcatgttcctggtgatctaccaaatggtcag
gtaccaccagcttatgcatcatcatcaggtcattatcagaacgataggtctgggccttct
cagtatggacgagataaccatggaaggtacccatatgcaagagacaaccaccatgattca
agaggaagggttccaccataccatcagagcggtggaaactcgtatcaatcacattctgct
ccatcagcaggtcctggacggtatgcgcaacccccaccatatgctggggggtatggtagg
agctaccagcctgcaccgtatggaggtggtcagcagtggcagcagcagcagcaacaacct
tatggctcctatgctgggtcagggccttatgggggtggggcacctcctgcaaggcctaat
tcacgaccacagcagtcgcagaaccgttacaataccttagataggaattctaacaggaga
cctccaccaggtcatgggcgacactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329368
Entry
4329368           CDS       T01015                                 
Name
(RefSeq) 5'-3' exoribonuclease 4 isoform X1
  KO
K12619  5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4329368
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329368
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4329368
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329368
   03009 Ribosome biogenesis [BR:osa03009]
    4329368
   03016 Transfer RNA biogenesis [BR:osa03016]
    4329368
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     4329368
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     4329368
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     4329368
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    4329368
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    4329368
SSDB
Motif
Pfam: XRN_M XRN_N
Other DBs
NCBI-GeneID: 4329368
NCBI-ProteinID: XP_015626966
LinkDB
Position
2:16617314..16633950
AA seq 853 aa
MQSCHGNTFFLQVAREQIPKHRLPGKGEPPCRWHRRLRQPLPRHESNHPLFLPPAGPDER
RHRCVRSDDGQRGFRVHVRLPGPLVSHRQAEKAPLLGSGFVVDVQQMDRWIDSLVKLLNG
VAPCAKMNGMRRGRRFAWVARASEEEEMQKISEGVSDPNVITPGTEFMEKISQALTYYIR
ARLNSSDPGWKHIMVILSDANVPGEGEHKIMSFIRAQRSMEGYDPNTRHCLFGHDADLIM
LALASHEVHFSILREDNSQLTEADPEKQYLFLNIWVLREYLEIELKILDPVCEPDIERLI
DDFIFICFLMGNDFIPHIPSLEMKEYALDLLIEVYKTTFNKMGGYIVNIEKVKDKHAAYL
EVSRLEIFFHQLSMYEEKIFLKRYELEQESLKKSCRDVLREASESERLELSRKLEDRFFN
EERPYDKLRLGLPGWKSRFYREYFGIETSNEIGNLQNDMAQKYLEGLCWMLQYYLADVPS
WSWYYPFYVAPFVSDLKSNCRFEISFTVDKPLRPFDQLMAVLPLRSSCALPECYRKVMGR
KEFDHPKLQADTIGKRFLWKKLFQCISEEELLQATKELDKELSMHEMRRNTPRQEKIFLQ
RNSNAQALAKVIVQLQTSSCSPEQKLPIDSAISGLGGWLSPDGLSNGFFCSPLQNLQDIT
NDQAISAMFFNPEAGNPIPRLLSNVKVPDKTVTEADISRRLLWHTYPGSRPPPPIVERPD
TIWKPISKPSAPREEHKNAGTGWMGRGRGNAALAAAETTTQLLTASSSSSSSYGHGAAGS
RTAAETQRSSSSSSSRRGSRRADMVAPQSRNSRFDDSDGGAYGFRPLGIGSAPWTGDGSG
GGHGRGRAQPRGW
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgcagagctgccatgggaataccttctttctacaggtggctcgtgaacagatacccaag
catcgtctccccggcaaaggagagccgccctgcagatggcatcgtcgtctacgacaacct
ctacctcgacatgaatcaaatcatccattattccttccacccgcaggaccagatgaacgc
cggcacagatgtgtgcgctccgacgacggtcagcgaggttttcgagtccatgttcgacta
cctggaccgcttgtttcgcatcgtcaggccgagaaggctcctctacttggcagtgggttc
gtcgtagatgtacagcagatggatcgttggatcgattctctcgtcaaattacttaatggg
gttgctccgtgcgccaaaatgaacggaatgcgaagaggacgacgtttcgcctgggtagcc
agagcgagtgaagaggaggaaatgcagaagatatcagaaggggtctctgaccccaatgtc
atcacgccagggactgaattcatggagaagatatcgcaagcgctcacgtactacatccgt
gccagattgaatagcagtgatccagggtggaaacacatcatggtaatactctctgatgca
aatgttcctggagaaggagagcacaagatcatgtctttcatccgtgcacagcgcagcatg
gaaggctatgaccccaacacacgacactgcttgtttgggcatgatgcggatttgatcatg
cttgctttggcatctcacgaagtccacttctctattttgcgtgaggataattcccagcta
acagaagcggatccagagaaacaatatctgtttttgaacatatgggttctgagagagtac
ttggagattgaattaaagatactggacccagtttgtgagcctgatattgagaggctgatt
gatgacttcatcttcatttgtttcttgatgggaaacgatttcatcccccacattccgtcg
cttgagatgaaggagtatgcacttgatcttctcatcgaggtatacaagacaaccttcaac
aaaatgggagggtatattgtcaacatagaaaaggtaaaagataaacatgctgcatatctg
gaagtctcaaggttggaaatattttttcatcaactgtccatgtatgaagagaaaattttt
ctaaaacgatacgaactggaacaggaatccctgaagaagtcatgtcgcgatgtgttgcgt
gaagcttcagaaagtgaaagattagagctgagccgaaaactagaggaccgcttttttaat
gaagaacgtccatatgacaaactaagacttggattgccaggatggaagtcccggttctac
agggaatatttcggtatcgaaacttctaatgaaattggaaatcttcaaaacgacatggct
cagaagtatttagaaggactttgttggatgcttcaatactatcttgcggacgtaccatca
tggagctggtactacccattctatgttgctcctttcgtatctgacctcaaaagtaattgt
cggttcgagatatctttcaccgtagacaaaccactgcgaccatttgatcagctcatggca
gttttaccactacgaagttcgtgtgctctcccagaatgttacagaaaagtaatgggccgt
aaagaatttgaccatccgaagttgcaggctgacacaattggaaaacgtttcttgtggaaa
aaattgtttcagtgtatctctgaggaagaactgcttcaggccaccaaagagttagataaa
gagctgtcgatgcatgagatgagacggaatactccccggcaagagaagatctttctgcag
aggaactcaaatgctcaggcacttgccaaagttattgtgcaactgcaaacatcgtcatgt
tcgccggagcaaaagcttccaatagattcagctataagtggacttggaggctggttatcg
cctgatggcttgagcaatggtttcttttgctcacccctacaaaatctgcaggacatcacg
aatgatcaggcaatatcagcgatgttcttcaaccctgaggcagggaatccaattccaaga
ctacttagcaatgtcaaagtacctgacaagacggttacggaagctgacatctcaaggagg
ctgctctggcacacgtacccgggctcgaggccgccaccgcccatcgttgagaggccggac
accatctggaagccgatcagcaagccgtcggcgccacgggaggagcacaagaacgccgga
accgggtggatggggcgggggagagggaacgccgcccttgccgccgccgagacgacgacg
cagctcctcaccgccagcagcagcagcagcagcagctacgggcatggggctgcaggcagc
cgcactgccgccgagacgcaacggagcagcagcagcagcagctccaggagaggttcccgt
cgtgcggacatggtggcgccgcaaagccgcaacagcaggtttgatgacagcgacggcggc
gcatacggtttccgaccgcttgggattgggagtgcgccgtggacaggagacggcagcggt
ggcggccatggccgcgggagagcgcagccacgtggttggtag

DBGET integrated database retrieval system