KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324993
Entry
4324993           CDS       T01015                                 
Name
(RefSeq) F-box protein SKP2A
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4324993
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324993
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4324993
SSDB
Motif
Pfam: LRR_6 LRR_4 F-box-like LRR_8
Other DBs
NCBI-GeneID: 4324993
NCBI-ProteinID: XP_015612144
UniProt: Q8RZQ3 Q0JH60
LinkDB
Position
1:complement(38275062..38279077)
AA seq 379 aa
MDGEQLMSGELDNSFNALMVSGEGESGQAHHEGTGTTLLGWKDLPMELLLRILSMAGDDR
MVIVGSGVCTGWRDTLEWGVTNLSLSWCQAHMNDLVMSLAQKFTKLQVLSLRQIKPQLED
SAVEAVANNCHDLRELDLSRSFRLSDRSLYALAHGCPHLTRLNISGCSNFSDAALAYLSS
QCKNLKCLNLCGCVRAVSDRALQAIACNCGQLQSLNLGWCDSVTDKGVTSLASGCPELRA
LDLCGCVLITDESVVALANGCPHLRSLGLYYCQNITDRAMYSLAANSRRVRSKGRSWDAA
ARKNAGAGADGLASLNISQCTALTPPAVQAVCDSFPALHTCPERHSLIISGCLSLTSVHC
ACAHHPHRHGRAILSNHAY
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggacggtgagcagctgatgagtggtgaattggacaattcgttcaacgcactcatggtt
tctggagagggtgagagtggacaggcacatcatgagggcacagggactaccttgttaggt
tggaaggaccttcccatggagctgctcctgcggatattatcgatggctggagacgacagg
atggtaatcgtgggctctggtgtttgcaccggttggcgtgatacattagaatggggagtc
acgaatctttctctttcgtggtgccaggctcacatgaatgacttagtgatgtcacttgct
cagaaatttacgaagctgcaagttctttctttacggcaaatcaaacctcagctcgaggac
agtgcagtggaggctgtagcaaataactgtcatgatttacgcgagttggatcttagcaga
agctttaggcttagcgaccgatcgttgtatgctctggcacatggatgcccccatcttaca
aggctcaacatcagtggatgttccaatttcagcgatgctgctttggcctatctcagtagc
cagtgcaagaacctgaaatgcctgaatctgtgcgggtgtgtgagggcagtttccgacaga
gcattgcaggccatcgcctgtaactgtggtcagcttcagtctttgaacctaggctggtgt
gatagtgtaactgacaagggagtgaccagcttggcatcagggtgccctgaacttcgggct
ctggacttgtgtggctgtgttctgataacagatgagagcgtggtcgctcttgccaatggc
tgccctcacctgcggtcgctggggctctactactgccagaacatcaccgaccgggcaatg
tactcgctggcggcgaacagccggcgggtgaggagcaaaggccggagctgggacgcggcg
gcgaggaagaacgccggcgccggcgccgacgggctggccagcctgaacatcagccagtgc
acggcgctgacgccgccggcggtccaggcggtgtgcgactccttcccggcgctccacacg
tgcccggagcggcactccctcatcatcagcggatgcctcagcctcacctccgtccactgc
gcctgcgctcaccacccgcaccgccatgggagggccatcctctccaaccatgcctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338850
Entry
4338850           CDS       T01015                                 
Name
(RefSeq) F-box protein SKP2A
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4338850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4338850
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4338850
SSDB
Motif
Pfam: LRR_6 LRR_4 F-box-like F-box LRR_8
Other DBs
NCBI-GeneID: 4338850
NCBI-ProteinID: XP_015640280
UniProt: Q0DI11
LinkDB
Position
5:20848454..20851098
AA seq 376 aa
MVSGRSANGELDACFRSLMLSISSGRGQAEGGGAMPTLSGWKDLPIELLLRIMSIIGDDR
MLVVASGVCTGWRDALGWGLTNLSLSRCQQNMNNLMISLAHKFTKLQVLTLRQNIPQLED
SAVEAVSNYCHDLRELDLSRSFRLSDRSLYALARGCPQLTKLNISGCSNFSDTALTYLTF
HCKNFKCLNLCGCGKAATDRALQAIARNCGQLQSLNLGWCEDVTDKGVTSLASGCPDLRA
LDLCGCVLITDESVIALATGCPHLRSLGLYYCQNITDRAMYSLANSRVKSKRRRWDSVRS
SSSKEEDGLANLNISQCTALTPPAVQAVCDSFPALHTCPGRHSLIISGCLSLTSVHCACA
LHPHRAGRTMVPSHAY
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggttagtgggaggtcagcaaatggggaattggatgcatgcttcagaagcctcatgctt
tcgatcagcagcgggagggggcaggctgaaggtggtggtgcaatgccaaccttgtcaggc
tggaaggaccttcctattgagctgcttctgcggatcatgtcgataattggagatgaccgg
atgcttgtcgtggcatccggtgtttgcactggctggcgcgacgcgctgggatgggggctt
actaatctttccctctcacggtgccagcagaacatgaataacttaatgatatcacttgct
cacaagttcacgaagcttcaagttctcactcttcgccagaacatacctcagcttgaagac
agtgcagtagaggccgtttccaactactgtcatgatctacgtgagttagaccttagcaga
agttttaggcttagtgaccgttccttgtatgcattagcccgtggctgtcctcagcttaca
aaattaaacattagtggatgttccaacttcagtgacactgccttgacctatcttactttc
cactgtaaaaattttaagtgcttgaatctatgtggttgtgggaaggcagcaaccgacaga
gctttgcaggccatagcccgtaattgcggccagctgcaatcattgaacttaggttggtgt
gaggatgtcacagataagggagtgaccagcttggcatcagggtgtcctgatctcagggct
ctggacttgtgtggttgtgttcttataacagatgagagtgtgatcgctcttgccactggg
tgtccacacctgcgatctttaggcttgtactactgccagaacatcaccgaccgagccatg
tactccctcgcaaacagccgggtcaagagcaaacgcaggaggtgggacagtgtgaggagc
agcagctctaaggaagaagacggtctcgcaaacctgaacatcagccagtgcacggccctg
acacccccagcggtccaggcggtctgcgactccttcccggccctccacacttgccctggg
aggcactccctgatcatcagtggctgcctcagcctgacgtctgtccactgcgcctgcgcc
ctccacccgcaccgtgctggaagaaccatggtgcctagccacgcatactga

DBGET integrated database retrieval system