KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325003
Entry
4325003           CDS       T01015                                 
Name
(RefSeq) gibberellin 20 oxidase 2
  KO
K05282  gibberellin-44 dioxygenase [EC:1.14.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00928  Gibberellin A4/A1 biosynthesis, GA12/GA53 => GA4/GA1
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4325003
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.12  gibberellin-44 dioxygenase
     4325003
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4325003
NCBI-ProteinID: XP_015627721
UniProt: Q0JH50 B6F2D9
LinkDB
Position
1:38382358..38385504
AA seq 389 aa
MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAE
LDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFR
LPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGP
DFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEP
ERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRY
KSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRA
DTRTLDAFTRWLAPPAADAAATAQVEAAS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccacc
gccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagccc
aagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggag
ctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgc
cgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgag
cacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgc
ctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacacc
agcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggc
ttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggcccc
gacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcg
ctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggag
ttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccg
gagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccag
gacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtc
cccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtat
aagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttc
ttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcag
cactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgcc
gacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgcc
gcgacggcgcaggtcgaggcggccagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334841
Entry
4334841           CDS       T01015                                 
Name
(RefSeq) gibberellin 20 oxidase 1
  KO
K05282  gibberellin-44 dioxygenase [EC:1.14.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00928  Gibberellin A4/A1 biosynthesis, GA12/GA53 => GA4/GA1
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4334841
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.12  gibberellin-44 dioxygenase
     4334841
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N DUF4351 DUF2793
Other DBs
NCBI-GeneID: 4334841
NCBI-ProteinID: XP_015628526
UniProt: P93771
LinkDB
Position
3:36150594..36152509
AA seq 372 aa
MSMVVQQEQEVVFDAAVLSGQTEIPSQFIWPAEESPGSVAVEELEVALIDVGAGAERSSV
VRQVGEACERHGFFLVVNHGIEAALLEEAHRCMDAFFTLPLGEKQRAQRRAGESCGYASS
FTGRFASKLPWKETLSFRYSSAGDEEGEEGVGEYLVRKLGAEHGRRLGEVYSRYCHEMSR
LSLELMEVLGESLGIVGDRRHYFRRFFQRNDSIMRLNYYPACQRPLDTLGTGPHCDPTSL
TILHQDHVGGLEVWAEGRWRAIRPRPGALVVNVGDTFMALSNARYRSCLHRAVVNSTAPR
RSLAFFLCPEMDTVVRPPEELVDDHHPRVYPDFTWRALLDFTQRHYRADMRTLQAFSDWL
NHHRHLQPTIYS
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgagcatggtggtgcagcaggagcaggaggtggtgttcgacgcggcggtgctgagcggg
cagacggagatcccgtcgcagttcatatggccggcggaggagagccccgggtcggtggcg
gtggaggagctggaggtggcgctgatcgacgtgggggcgggggcggagaggtcgtcggtg
gtccggcaggtgggggaggcgtgcgagaggcacggcttcttcctggtggttaaccacggc
atcgaggcggcgctgctggaggaggcgcaccggtgcatggacgccttcttcacgctgccg
ctgggggagaagcagcgggcgcagcggcgcgcgggggagagctgcggctacgccagcagc
ttcacggggcgcttcgcgtccaagctgccgtggaaggagacgctgtcgttccggtactca
tcggctggagatgaagagggcgaggagggcgtgggtgagtacctggtgcggaagctcggg
gcggagcacgggcggcggctgggcgaggtgtactcgcgctactgccacgagatgagccgc
ctgtcgctggagctgatggaggtgctcggggagagcctgggcatcgtcggagaccggcgc
cactacttccggcgattcttccagcgcaacgactccatcatgcgcctcaactactacccg
gcgtgccagaggccactcgacacgctgggcaccggtccgcactgcgaccccacctcgctc
accatcctccaccaggaccacgtcggcggcctggaggtgtgggcggaggggcggtggcgc
gccatccgccctcgccccggggcgctcgtcgtcaacgtcggcgacaccttcatggcgctc
tccaacgccaggtaccgcagctgcctgcaccgggcggtcgtcaacagcacggcgcctcgc
cgctcgctggccttcttcctctgcccggagatggacacggtggtgcgcccgccggaggag
ctggtcgacgaccaccacccgagggtgtacccggacttcacgtggcgggcgctgctggac
ttcacgcagcgccactacagggccgacatgcgcacgcttcaggccttctccgactggctt
aatcatcatcgtcacctgcaaccaacaatatactcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269090
Entry
9269090           CDS       T01015                                 
Name
(RefSeq) gibberellin 20 oxidase 2-like
  KO
K05282  gibberellin-44 dioxygenase [EC:1.14.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00928  Gibberellin A4/A1 biosynthesis, GA12/GA53 => GA4/GA1
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    9269090
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.12  gibberellin-44 dioxygenase
     9269090
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N RhoGEF
Other DBs
NCBI-GeneID: 9269090
NCBI-ProteinID: XP_015637407
LinkDB
Position
5:complement(20685324..20692269)
AA seq 445 aa
MHASPHPLQIAHDTLLLSLTHTLCTAETGSTIRTGTAMVYISNAQDASKLIVTAKGGGGE
ADDAAASSAAVVLDLWRQPAKIPAPFVWPRADVALPPSSPPTGELDVPVVDLAAALRDAA
GMRRAVAQVAAACASHGFFQVSGHGVPPSLARAALDGAAGFFRLPPAAKQRARRAPGTVT
GYTAAHADRFVDNLPWKETLSFGHRHANAAGNNSSTVADYFSTLGDDFKHLGEVYQEYCE
AMEEVTKAIMAVLGESLGVGGGYYREFFEDSSSIMRCNYYPPCPEPERTLGTGPHCDPSA
LTVLLQDGDVDGLQVLVAGAWRPVRPLPGAFVVNIGDTFMALTNGRYKSCLHRAVVHREQ
ERRSLAFFLCPREDRVVRPPAGAGAGERRLYPDFTWADFMRFTQRHYRADTRTLDAFARW
LRPPACSGAAPVVGPPTTATQAATV
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcatgcatctcctcacccattacaaatagcacacgacactctgctcctttctctcaca
cacacactctgcactgcagaaaccggctcgaccatacgtacaggtacagccatggtgtac
atctcgaacgcgcaggatgccagtaagctgatcgtgacggcgaagggaggaggaggagaa
gccgacgacgccgccgcctcctccgctgccgtcgtccttgacctctggcggcagccggcc
aagatcccggcgccgttcgtctggccgcgcgccgacgtcgcgctgccgccgtcgtcgccg
ccgacgggggagctggacgtgcccgtggtcgacctcgccgcggcgctacgcgacgccgcc
gggatgcgccgcgccgtcgcgcaggtggccgccgcgtgcgcgagccacgggttcttccag
gtgagcgggcacggcgtgcccccgtcgctggcgcgcgccgcgctcgacggcgccgcgggc
ttcttccgcctcccgcccgccgcgaagcagcgcgcccgccgcgccccaggcacggtcacc
ggctacaccgccgcccacgccgaccgcttcgtcgacaacctcccctggaaggagacgctc
tccttcggccaccgccacgccaacgccgccggcaacaactcctccaccgtcgccgattac
ttctccaccctaggcgacgacttcaaacacctaggggaggtgtaccaggagtactgcgag
gcgatggaggaggtgacgaaggcgataatggcggtgctaggggagagcctgggggtgggg
ggcggatactacagggagttcttcgaggacagcagctcgatcatgcggtgcaactactac
ccgccgtgcccggagccggagaggacgctggggacggggccgcactgcgacccgtcggcg
ctcaccgtgctcctccaggacggcgacgtcgacggcctccaggtgctcgtcgccggcgcg
tggcgccccgtgcggccgctgcccggcgcgttcgtcgtcaacatcggcgacaccttcatg
gcgctgacgaacggccggtacaagagctgcctgcaccgggcggtggtgcaccgggagcag
gagcggcggtcgctggccttcttcctctgcccgcgcgaggaccgcgtggtgcggccgccc
gccggcgccggcgccggcgagcggcggctctacccggacttcacctgggccgacttcatg
cgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcgcccgctgg
ctccgcccgccggcctgctccggcgccgcgccggtcgtcggcccaccgacgacggcgacc
caggcggccaccgtctag

DBGET integrated database retrieval system