KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325029
Entry
4325029           CDS       T01015                                 
Name
(RefSeq) PTI1-like tyrosine-protein kinase 1
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4325029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4325029
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4325029
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4325029
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH ABC1
Other DBs
NCBI-GeneID: 4325029
NCBI-ProteinID: XP_015621476
UniProt: A0A8J8Y7L5 Q5N854
LinkDB
Position
1:complement(39091691..39095347)
AA seq 369 aa
MVRWRRWICCNCQVNESDQLENGHAKVLTSNADGVTKGLKDSATEKAQPQNSALTINIPV
LSLDELVEKTDDFGSSALIGEGSYGRVYYAVLDSGTKIAVKKLDSNENEPTSEFLTQVAL
VSRLKHENFVDMLGYCTEGNLRLVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWMQRVR
IAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKVADFNLSNQAPDMAARLHSTR
VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL
TEDKVKQCIDPRLNGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLTSKPTP
PAPPPALDG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtaaggtggcgccgctggatctgctgcaattgtcaagtgaacgagtctgatcagctt
gaaaatggacatgccaaggtcctgactagtaatgcagatggagtgacaaagggtttgaaa
gattctgctactgaaaaagctcagccacaaaattcggctctcactatcaatattcctgtt
ctatccttggacgaactagtagaaaagacagatgattttggctcaagtgctttgataggc
gaaggttcttatggtagagtgtactacgctgttcttgacagtggaacaaaaattgcagtg
aagaaacttgattctaatgaaaatgagcccacttcagaattcttgacccaggtcgctttg
gtttcaagattgaaacatgaaaactttgtagatatgttgggatactgcacggagggtaac
cttcgcctagtagcatatgaatttgccactatgggttcactgcatgatgttctacatgga
agaaaaggggtgcaaggtgcacaacctggtccagcacttgattggatgcaacgagtaaga
atagctgttgatgctgccaaaggacttgaatatctacatgagaaggttcagccctccatt
gttcatagggatattagatcaagtaacatactcttatttgaagacttcaaggcaaaagtt
gcagacttcaatctctcaaatcaggctccagatatggctgctcgtctgcattctactcgt
gtactgggaacctttggttatcatgctccagagtatgcaatgaccggtcagctgacacag
aaaagtgatgtgtatagcttcggagttgttctcttggaacttctgacaggaagaaaacca
gtagatcatacaatgcctagagggcagcagagcttggttacatgggctacaccaagatta
actgaagataaggtgaagcagtgtatagatccacggttgaatggtgaatacccaccaaaa
ggagttgccaagcttgcagcggttgcagcattgtgcgtacaatacgaagctgagtttcgc
ccaaacatgagcattgtggtgaaggctttatctccactgctcacaagtaagccgactcca
cccgcgcctccaccagctctggacggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326993
Entry
4326993           CDS       T01015                                 
Name
(RefSeq) pto-interacting protein 1
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326993
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4326993
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4326993
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4326993
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 4326993
NCBI-ProteinID: XP_015621698
UniProt: Q9AWP9 A0A8J8YNX7
LinkDB
Position
1:complement(12332865..12337225)
AA seq 371 aa
MGCFSCCGADDVGKKKKRDDPYVPIPDPGGNYGRSKPGPPAPSRSPPTSRNLPIAVPAIP
LDEIKGITKNFSSDALIGEGSYARVFFGVLRDGRRSAVKKLDSSKQPDQEFLVQVSAVSR
LKHENIIQLIGYCAGGSIRVLAYEYAPRGSLHDILHGKKGVKGAQPGPALSWMQRVKIAL
SAAKGLEFLHEKAEPRVVHRDIKSSNIMLFDNDVAKVGDFDVSNQSPDMAARLHSTRVLG
TFGYHAPEYAMTGQLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED
KVKQCVDPRLEGDYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALNPLLNSRPNNRPA
SFTDAGERSGL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggttgcttttcatgctgcggagcggatgatgtcggcaagaagaagaagcgcgacgat
ccttacgtcccgatccctgatccaggtggtaactatggacgtagcaagcccgggccccca
gccccttcgcgttctccccccaccagcagaaatctgccaattgcagtaccggcaattccc
cttgatgaaataaagggaataaccaagaacttcagcagtgatgctctcatcggagaaggc
tcgtacgccagagttttctttggtgtgctgagagatggcaggagatctgcggtgaagaag
ctcgactccagcaaacagcctgatcaagaattccttgtgcaggtttcagccgtttcacga
ctgaagcatgagaatattatccaacttatcggatattgcgctggagggagcatccgtgtt
cttgcttatgagtatgcaccgaggggctccttgcatgacattctccatggtaaaaagggt
gtgaagggagctcagccaggaccagctctatcatggatgcagcgagtgaagattgccttg
agtgctgcaaaggggcttgagttcctgcacgagaaggcggagcctcgtgtcgtccaccgt
gacatcaaatccagcaacattatgctctttgacaacgatgttgcgaaagtaggagacttc
gatgtatccaatcagtccccggacatggcggctcgcctccactccactcgtgttcttggc
accttcggttatcatgctcctgagtacgcgatgacagggcagcttagcacgaagagcgat
gtctatagcttcggagtcgtgttgctggagcttttaactggtcgcaaaccggtcgatcat
acgctgccccgtggccagcagagtcttgtgacatgggctactccaaggctaagtgaagac
aaggtgaagcaatgcgtggatccaaggcttgaaggggattatcctcccaaggctgttgcc
aagatggctgccgtagctgcgctgtgcgtgcagtacgaggcggacttcaggcccaacatg
agcatcgtcgtcaaggctctgaacccactcctcaacagccgcccgaacaatcgccccgcc
tccttcaccgacgccggcgagcgatccggattatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334756
Entry
4334756           CDS       T01015                                 
Name
(RefSeq) PTI1-like tyrosine-protein kinase 1
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4334756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4334756
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4334756
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4334756
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH Pkinase_fungal
Other DBs
NCBI-GeneID: 4334756
NCBI-ProteinID: XP_015632844
UniProt: Q75LD0 B9F7J5
LinkDB
Position
3:complement(35480666..35486342)
AA seq 368 aa
MRQWFCCNCHFDEEDDHGKERSNAQGNKMDAKQKSSKPPAGQPEPEIAPLTIDVPELSLE
DLKQKTDNFGSNALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSQASRL
KHENLVEMLGYCVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWTQRVKIAIE
AAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGT
FGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDK
VKQCVDPRLKSEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQKPAVPAAS
EPAPATEN
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaggcagtggttttgttgtaattgccactttgacgaggaggatgaccatgggaaggaa
cgctccaatgctcagggcaataagatggatgccaagcaaaagtcttcaaaacctcctgct
ggtcaacctgaaccagagatagccccacttacaattgatgtccctgagttgtcactggag
gacttaaaacaaaaaaccgacaattttggatcaaatgctctgattggtgaaggttcatat
ggacgagtataccatgccactttggatgatgggaggcaagcagcagttaaaaaattggat
gcatctgaaaatgagcctaacgacgaattcttgaaacaggtctcccaggcatcaaggcta
aagcatgaaaatcttgtggagatgttgggttactgtgtagagggcaattatcgtatactg
gcatacgaatttgcgaccatgggttcccttcatgatgttctccatggaagaaaaggagtt
caaggtgcgcagcctggtcctgtacttgattggacgcagagggtaaaaattgctatagag
gcagcaaaaggcttagagtacctgcatgagaaggttcagccttcaatcattcatcgggac
atcagatcaagcaatgtacttctgtttgaggacttcaaggcaaaaattgcagatttcaat
ctcttaaatcaagctccagatatggcagcacgccttcattcaactcgtgtattaggaacc
tttggatatcatgcaccagaatatgctatgactggccagctgacgcagaagagtgatgtg
tacagttttggtgtagttcttttggaactcctgactggaaggaaaccagtggaccacaca
atgcctcggggacagcaaagtctagtcacttgggctactcctagattaagcgaagacaag
gtcaaacaatgtgtagatcctaggttaaagagtgaatatcctccaaagggagttgctaag
cttgctgcggtggcagctctttgtgtccaatacgaagcagagttcaggcccaacatgagc
attgttgtcaaggcgctctctcctctgcttcaacaaaaaccagcagtgccagctgcctca
gagccggcgccagcaactgagaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336242
Entry
4336242           CDS       T01015                                 
Name
(RefSeq) PTI1-like tyrosine-protein kinase 3
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4336242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4336242
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4336242
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4336242
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 4336242
NCBI-ProteinID: XP_015636544
LinkDB
Position
4:24512400..24515368
AA seq 366 aa
MPAMGLWESVRSLFGEGGNGCLPRIGKKESEDLYSYPVDHDKRKGADRAAAEEVVTVEVP
EVPVRELNEITNSFSNENLIGQGSYAKVYRVLMRGARPAVVKKLEKPSKHASNVVFLKQL
SVASRLKHENFVRLLGYTISGDLRVLVYEYAAMGTLHDVLHGPRDGQGWGGEAKAVVSWE
QRVRIALDAARGLEYLHEKVQPAVTHKDVRSTNVLLFEGFRAKIADYNMFSQAADMARLN
RSTHTLGSFGYQAPEYAMTGQMNDKSDVYSFGIVLLELLTGRKPLDRTLPQGQRSLVNWA
TPILTEDRVQDCIDPNLGDKYPPTGALKLGRIAVQCLQYDPTFRPSMGTVARVINYAVVR
DQQGVV
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgccggcgatggggttgtgggagagcgtgaggagcttgttcggggagggaggcaacggc
tgcctacctcggattgggaagaaagagtccgaggatctttactcttatccagtggatcat
gataaacggaaaggagcggaccgtgcggccgcggaggaggtggtgacagtggaggtgccg
gaggtgcccgtgcgcgagctgaacgagatcaccaactccttctcgaacgagaacctcatc
gggcagggctcctacgcgaaggtgtacagggtcctcatgcgcggcgcgaggcccgccgtc
gtcaagaagctcgagaagccgtccaagcacgcgtccaacgtcgtcttcctcaagcagctg
tcggtggcgtcgcggctgaagcacgagaacttcgtcaggctgttggggtacacgatcagc
ggcgacctccgcgtgctggtctacgagtacgccgccatgggcaccctccacgacgtcctg
cacgggccgagggacggacaggggtggggcggggaggcgaaggcggtggtgagctgggag
cagcgggtgcggatcgcgctggacgcggcgcgcgggctggagtacctgcacgagaaggtg
cagccggcggtgacgcacaaggacgtgcgttccaccaacgtgctgctgttcgaggggttc
agggccaagatcgccgactacaacatgttcagccaggccgccgacatggctcgcctcaac
cgctccactcacaccctcggctccttcggataccaggcgccggagtatgccatgactggt
cagatgaacgataagagcgacgtttacagttttgggattgttctgctggagctcttgacg
gggaggaagccgctggaccggacgttgccgcagggtcagagaagcctggttaactgggca
actccaattttgactgaagacagggtccaggactgcatcgaccccaatcttggcgacaag
tatcctcctaccggagctctcaagctggggagaatcgcggtgcagtgcctgcagtacgac
cctacgttccggccatcgatgggcaccgttgcccgcgtcatcaactacgccgtcgtgcga
gaccagcaaggcgtggtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337734
Entry
4337734           CDS       T01015                                 
Name
(RefSeq) pto-interacting protein 1
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4337734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4337734
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4337734
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4337734
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH DUF2239
Other DBs
NCBI-GeneID: 4337734
NCBI-ProteinID: XP_015638781
UniProt: Q75L45 Q6AVZ1
LinkDB
Position
5:2096016..2100415
AA seq 361 aa
MSCFACCGDEDTQGVPDNRNPYPGNHPARSDAYRTADPTPRGPQPVKVQPIAVPIIPVDE
IREVTKNFGDEALIGEGSFGRVYFGVLRNGRSAAVKKLDSSKQPDQEFLAQVSMVSRLKH
EHVVELLGYCVDGNLRVLAYEFATMGSLHDMLHGRKGVKGAQPGPVLSWAQRVKIAVGAA
KGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFG
YHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVR
QCVDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNARATNPGENAG
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcgtgctttgcatgctgtggtgatgaagatactcaaggagtaccagacaacaggaat
ccatacccagggaaccatccagcaaggagcgatgcatatcgcacagctgatccaactcca
agaggtcctcaacctgtgaaagtgcaaccaattgcagtccccatcattcctgttgatgaa
attagggaagtgactaagaattttggtgatgaagctttgattggtgaaggttcctttggc
agagtgtattttggtgttctaagaaatggtagaagtgcagcggtcaaaaagctagactct
agtaagcagccagaccaagaatttttggcacaggtatctatggtgtcgaggcttaagcat
gaacatgttgttgagctgcttggttattgtgttgatggaaatctccgtgtccttgcttat
gagtttgcgactatgggttctcttcatgatatgcttcatggaaggaagggtgttaaagga
gctcaacctggtccagtcttatcatgggcacaacgtgtgaagatagctgttggggcagca
aaaggcctggagtatcttcatgagaaagcacagcctcatatcatacacagggacatcaag
tccagcaatgttctccttttcgatgatgatgttgctaaaatagctgactttgatttgtca
aaccaagctcctgacatggcagctcggcttcactctactagggttcttggaacctttgga
tatcatgcacctgagtatgcaatgactggacagcttagctccaagagtgatgtgtacagt
tttggagttgttcttcttgagctattgaccggaaggaaacctgttgaccatacattacca
aggggacagcagagtcttgtgacttgggccaccccaaggcttagtgaagacaaggttagg
caatgtgttgactcaagacttggaggggactatcctcctaaagctgtcgcaaagtttgca
gctgttgcggcgttatgcgttcagtatgaagcggactttcgaccaaacatgagcattgtc
gtgaaagcgctgcaacccctgctgaatgctcgggcaactaaccctggagaaaatgccggg
tcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347559
Entry
4347559           CDS       T01015                                 
Name
(RefSeq) PTI1-like tyrosine-protein kinase 3 isoform X1
  KO
K13436  pto-interacting protein 1 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347559
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4347559
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4347559
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4347559
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ABC1 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 4347559
NCBI-ProteinID: XP_015611903
LinkDB
Position
9:19991619..19995784
AA seq 362 aa
MLRRWFCCTQFHAPYREHENEFPDIPEEKEAGNGFAPKSDDPTKAPPPIEVPELSFDELK
EKTDNFGSKALVGEGSYGRVYYATLDNGKQVAVKKLDASTEPEVDNDFLTQVSIVSRLRH
ENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVRIAIDAA
KGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNPSNQSPDMAARLHSTRVLGTFG
YHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVK
QCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHKPPPPPAVAP
ET
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgttgcgacgctggttctgctgcactcagtttcacgcaccatatcgtgaacacgaaaat
gaatttcctgacatcccagaggagaaagaagcaggaaatggttttgctcccaaaagtgat
gatcccacaaaagcacctcctcccattgaagtaccagaattatcatttgatgaactgaaa
gagaaaactgataattttggttcaaaggctttagttggtgaaggatcatatggaagagtg
tattatgctactctagacaacggaaagcaagttgctgttaaaaagcttgatgcttcaaca
gaacctgaggttgataatgattttttgacacaggtgtccattgtgtcaagattaagacat
gaaaattttgtggaaatgcttggttactgtgtggaaggaaatcagcgcctagtggcctac
gaatttgctacgatgggttctctgcatgatattttgcatggaagaaagggtgtccctggt
gcacaacctggcccagcacttgactggatgcagcgagtgagaattgctattgatgctgct
aaagggctagaatatcttcatgagaaggtccaaccttctatagtccatcgggacatacgc
tctagcaatgttcttctatttgaggactacaaagcaaaaattgcagatttcaatccttca
aatcagtctcctgatatggctgctcgtttgcactcaactcgtgtccttggaaccttcggc
tatcatgctcccgagtatgccatgactggccagttgactcagaaaagtgatgtatatagt
tttggagttgttcttctagagcttctaacaggaaggaaaccagtagatcacacaatgcct
aggggtcagcagagtctggttacatgggcaacacctcgtttgacagaggacactgtgaaa
caatgcgttgacccgagactgaagggcgagtatcccccaaaaggggttgccaagctcgca
gcggtggcggcactctgtgtgcaatacgagtctgagtttagaccaagcatgagcattgtg
gtcaaggcactctcccctcttctccagcataaaccgccaccgccaccagccgttgctcct
gagacctga

DBGET integrated database retrieval system