KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325041
Entry
4325041           CDS       T01015                                 
Name
(RefSeq) DNA repair protein recA homolog 3, mitochondrial
  KO
K03553  recombination protein RecA
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4325041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325041
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     4325041
    RecFOR pathway proteins
     4325041
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    4325041
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_25 AAA_16 AAA_24 AAA CobU AAA_35 AAA_14 AAA_22 AAA_33
Other DBs
NCBI-GeneID: 4325041
NCBI-ProteinID: XP_015612195
UniProt: A0A0P0VBR6 B9EVE4
LinkDB
Position
1:complement(39238851..39243981)
AA seq 429 aa
MANLLRRASLRRAVAAVAAAAAPCPESYKQGICGSTFHCRYFSSKAKKKTKSSGTDSGEE
NLSKKDLALHQAIDQITSAFGKGAIMWLGRSEGRREVPVVSTGSFSLDLALGTGGLPKGR
VIEVYGPEASGKTTLALHVIAEAQKHGGYCAFVDAEHALDPALAESIGVNTSNLLLSQPD
CGEQALSLVDTLIRSGSVDVVVVDSVAALVPKSELDGEMGDAHVALQARLMSQALRKLSH
SLSLSQTILLFINQIRSKVTTFGGFGGPMEVTSGGNALKFYASVRMNIKRIGLVKKGEET
IGSQVLVKIVKNKHAPPFKTAQFELEFGKGICRSSELIELGLKHKLVKKLGGAFYSFNEE
SYRGKDALKSYLNENESIAKELETNLRKLMETQAPKKQEDEGDFLSDLPEESLATETSSE
EELAAVIEA
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcgaacctcctgaggcgcgcgtcgctgcggcgcgccgtcgccgccgtcgcggcagca
gccgcgccctgccccgagagctataagcaagggatctgtggctctactttccactgccgg
tatttctcgtctaaagccaaaaagaagacaaagtccagtggaactgactctggtgaagag
aatctgtcaaagaaagacttggctctacaccaggctattgatcaaataacatctgcattt
gggaagggcgcaataatgtggcttggtcgttctgaaggtcgtagagaagtacctgttgtg
tcaactgggtctttctctttggatttggcattgggaactggtggacttccaaagggtcgt
gttatagaggtgtatggtccagaagcttcaggcaagacaactcttgcacttcacgttatt
gcagaagcacaaaagcatggcggttattgtgccttcgtagatgcagagcatgccttagat
ccagctctggctgaatcaattggggtcaacaccagtaatttacttctctctcagccagac
tgtggcgagcaggcactcagtcttgtggacacactgattcgaagcggctctgttgatgtt
gttgttgttgatagtgtagcagctcttgtccctaagagtgagcttgacggggagatgggt
gatgcacatgttgctctccaggctagattgatgagccaagctcttcgcaagctgagccac
tctctctcactttcccagacaattttgttattcattaaccagatcaggtctaaagtgacc
acatttggaggatttggaggtccaatggaggttacttctggtggaaatgcccttaaattc
tatgcttccgttagaatgaacatcaagcgtattggtttggtaaagaaaggcgaagagact
ataggtagtcaagtgcttgtgaagattgtgaaaaacaagcatgccccaccgttcaagaca
gcacagtttgagctggaatttggtaaagggatatgccgcagttcagagcttattgaactt
ggattaaagcacaagcttgtcaaaaagttgggtggtgcattttattctttcaacgaagag
tcatatcgtggtaaagatgcccttaaatcttacctcaacgaaaatgaaagtatcgcaaaa
gaactggagacgaatttaaggaaattgatggaaactcaagcacctaaaaagcaggaggat
gaaggtgatttcctgagtgatctgcctgaagagagtctcgccactgaaacatcctccgag
gaggaactggcagctgtaatagaagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333537
Entry
4333537           CDS       T01015                                 
Name
(RefSeq) DNA repair protein recA homolog 1, chloroplastic
  KO
K03553  recombination protein RecA
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4333537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4333537
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     4333537
    RecFOR pathway proteins
     4333537
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    4333537
SSDB
Motif
Pfam: RecA Rad51 ATPase AAA_25 AAA_24 ATPase_2 DUF4113 AAA
Other DBs
NCBI-GeneID: 4333537
NCBI-ProteinID: XP_015627776
UniProt: Q10G85 Q0DQ36
LinkDB
Position
3:24591376..24596460
AA seq 418 aa
MAAATVAASSRFGPAHLLPRSRRKGRAPAPSARATACGAVGRGRRLRCEFVAGGGNGALS
GEDDPRLIDRQKALDAAMNDINSSFGKGSVTRLGSAGGAFVETFPSGCLTLDFALGGGLP
KGRVVEVYGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPAYSKALGVDIENLIVC
QPDNGEMALEIADRMCRSGAIDLICIDSVSALTPRAEIEGEIGMQQMGLQARLMSQALRK
MSGNASKAGCTLMFLNQIRYKIGVFYGNPEVTSGGIALKFFASVRLEIRPIGKIKSAKGD
EDVGVKVRVRVQKSKVSRPYKQAEFEIIFGEGVSKLGCVLDCAELMEVVAKKGSWYSYKE
MRLGQGREKALQYLRESPTICDEIEKAVRAMIPEGARHMSLLAFGRSSLTEEEQVDDE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccgccgccaccgtcgcagcctcctcccgcttcggccccgcccacctgcttccccgc
tcccgcaggaaggggagggcccccgcgccgagcgcgcgcgccacggcctgcggagccgtc
gggcgaggccgccggctgcgctgcgagttcgtggccggcggcgggaacggcgcgctctcc
ggggaggacgacccgcgcctcatagaccgccaaaaagctcttgatgcagccatgaatgac
ataaacagctcctttggaaaaggcagtgttacaagattaggaagcgcgggtggtgccttt
gttgagacatttccaagtggctgcttgacactagattttgccttgggtggtggccttcca
aaaggaagagtagtagaggtgtatggtccagaaagcagtggaaagactactctagcgctg
catgccattgctgaagtacagaaattgggaggcaatgccatgcttgtggatgcagagcat
gcttttgatccagcttattctaaagcacttggggtagatattgaaaatctgattgtatgc
cagccagacaatggagagatggcactagaaattgcggaccgcatgtgcagatctggagct
atcgatctcatctgtattgattcagtgtcagctctcactccgcgtgcagaaattgaaggt
gagatagggatgcagcagatgggtttacaagcacgtctaatgagtcaagcattgagaaag
atgtcaggcaatgcctcaaaggctggttgtactcttatgttcttgaatcaaataagatac
aagattggagtattttatggtaatcctgaagtcactagtggagggatagctttgaaattc
ttcgcatcagttcgactagagatacggcccattggcaagataaaatctgccaagggagat
gaagatgtgggtgtgaaggttcgtgtcagagtgcagaagagtaaagtctccagaccctac
aagcaagctgaatttgagatcatctttggggagggcgttagtaaactgggatgtgttctt
gattgtgctgagctgatggaagtcgttgcaaagaaaggctcatggtatagctacaaagaa
atgagattgggtcaaggcagagaaaaagcactgcagtatctccgagagagccctaccatc
tgtgatgagatagaaaaggctgttcgagccatgataccagaaggagcaagacatatgagc
ctgctcgctttcgggcggtcatcattgaccgaagaagaacaagtagacgatgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350329
Entry
4350329           CDS       T01015                                 
Name
(RefSeq) protein RecA
  KO
K03553  recombination protein RecA
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4350329
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4350329
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     4350329
    RecFOR pathway proteins
     4350329
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    4350329
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA_25 AAA_16 ABC_tran AAA_35 CobU AAA_14 AAA MobB IKKbetaNEMObind
Other DBs
NCBI-GeneID: 4350329
NCBI-ProteinID: XP_015615298
UniProt: A0A0P0Y1E9 Q53QJ3
LinkDB
Position
11:complement(11361878..11368598)
AA seq 430 aa
MARALLLRRGHPFLRRLLRPPPPPTSSVLESCNRNVSPRVQLWRFSAEGKDQTNSSEDGY
SEANIKKKDFALQQALDQIKSAFGEESIMWLNHSYGPKEVPVISTGSFALDMALGIGGLP
KGRVVEIYGPEASGKTTLALHIIAEAQKNGGYCAFIDAEHALDPTLAESIGVKAEHLLLS
QPDCGEQALGLADILIRSGSIDVVVVDSVAALVPKTELDGEMGDAHVALQARLMSQALRK
LSHSLSRSRTMLVFINQVRSKLSTFSGFGAPAEVTCGGNALKFYASVRLNTKRIGLIKKS
EEVVGTQIQVKIVKNKHAPPFKTVHLELEFGKGLSRELEIIEVGFKHKFITKSGVFYHLN
GQNFHGKDALKCYLAENKNVLESLMSMIKESIMQQESHPDRNMEDANPDTSITEEFVSAT
DEQVPEEVEA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccagggccctcctcctccggcgcggccaccccttcctccgccgcctcctgcggcct
cccccgcctcccacctcctctgtactggaatcctgcaatagaaatgtgtcaccaagagtt
cagttgtggagattctctgcagaagggaaagaccagacaaattcaagtgaagatggttac
agtgaggcaaacattaagaagaaggactttgcgctacaacaagctttggaccaaattaag
tctgcatttggtgaggagtcaattatgtggctaaatcactcttacggtcctaaagaagtt
cctgtcatatctactggatcctttgcattggacatggctttaggaattggtgggctcccg
aagggaagggttgttgaaatttatggtccagaggcatcaggaaaaaccactttagcactt
catatcatagctgaagcacagaagaatggaggatattgtgcttttattgatgccgagcat
gccctggatccaacattagcagaatctataggtgttaaggcagaacacctgttattatct
caaccagactgtggtgaacaggcccttggtcttgctgatatcttaatccgaagtggctct
attgatgttgtggttgtggacagtgtagcagctcttgttccaaaaactgaactggatggt
gagatgggagatgcccatgttgcacttcaagcaaggcttatgagtcaagcacttcgcaag
ttgagccattctctttctcgctccaggacaatgttggtgtttattaatcaggtaagatcg
aaattaagcacatttagtggattcggagcaccagcagaagtaacctgtggagggaatgcc
ttaaagttctatgcttctgtccgcttgaacaccaaaaggattggtcttataaaaaagtca
gaagaggttgtaggcacacaaattcaggtcaagattgtcaagaacaagcatgcaccccca
tttaagactgtacaccttgagcttgagtttggtaagggcctgagtcgtgaattggagatt
attgaagtaggcttcaaacacaagttcataacaaaatcaggagtattctatcacttgaac
gggcaaaatttccatggaaaggatgctcttaaatgttatctcgctgaaaacaagaatgtc
ctggaatctctgatgtcaatgataaaggaaagcataatgcaacaggagtcccatccagat
agaaacatggaggatgccaacccagatacgagcataacagaagagttcgtttcagcaaca
gatgaacaagtacctgaagaggttgaggcctga

DBGET integrated database retrieval system