KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325055
Entry
4325055           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 12
  KO
K03126  transcription initiation factor TFIID subunit 12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4325055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4325055
   03036 Chromosome and associated proteins [BR:osa03036]
    4325055
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4325055
   Coactivators
    SAGA/TFTC/STAGA complex
     4325055
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     4325055
    STAGA complex
     4325055
    TFTC complex
     4325055
    SAGA complex
     4325055
    SLIK complex
     4325055
SSDB
Motif
Pfam: TFIID_20kDa CBFD_NFYB_HMF Cwf_Cwc_15 WD40_2 Exonuc_VII_L
Other DBs
NCBI-GeneID: 4325055
NCBI-ProteinID: XP_015621479
LinkDB
Position
1:complement(37118463..37123050)
AA seq 542 aa
MDAPPPAQPDAAAAAPAAPPTSTSASAPSSAPQPNPTPSASTAAPPTPDTTLAPAPNPTP
APVQTLETPAPSPASARPPVPRMRPPYTHLASPITMSSSPATGAASSSSASAPAATSASS
SAMPRGGVALGLPAHPRAPQTPVGYTGFVPPPTLAAQFGSMHRGPDQPPPSSTQPRQPSP
GIQNIGTVGSINTSQVRPGAISSLPQQTRPNFPSSTAPSPSDSQIASSQKTPIQALARPP
SMASSPSMPLQQTPPNVSAPLRPPQHRPHPRPYHAPAISHPQNALLTQQQQKLPQHQHLQ
QQQQQQQQQQKLQQQQQQQQQKLQQQQQQQQQKLQQQQQQQQNQPQHSSQQSQQTTTLRN
QQQISQQQTARTPVSMAQKLDSPAVLKATNVQSGDMASVDVDAGGSGNRLLSKRSIHELV
AQIDPSEKLDPEVEDVLIDIAEDFVESVATFACSLAKHRKSSILEAKDVLLHAERSWNIT
LPGFSGDEIKLYKKPHVNDIHRERLTLIKKSMASESNAKGSAAQAAANQKNQTPKPPATG
SP
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggacgcgcctccgcccgcgcaaccggacgccgccgcggcggcgccggcggcgccgccc
acttcgacctcggcttctgccccctcatccgcgccacagcctaatcccaccccttccgcc
tccaccgccgcgccgcccacccccgacaccacccttgccccggcccccaatcccacccca
gcccccgtccaaaccctagaaaccccagctccaagccccgccagtgcgcggccgccggtg
ccccgcatgaggcctccgtacactcacctggcctcgcccatcacgatgtcctcctctccg
gccacgggcgcggcctcttcctcctctgcttccgctccggccgccacctctgcgtcctca
tctgccatgccacggggaggtgtagcccttgggctaccagcgcacccgcgtgcgccgcag
acgcccgtcggctacaccgggttcgtgccgccgccgacactcgccgcgcagttcggctcg
atgcatcggggtcctgaccagcccccaccatcctctacacagcctaggcagccttcccct
gggatccaaaatattgggacagttggttccattaacacatctcaggtgagaccaggagca
atctctagtctgccacagcagacaaggccaaattttccatcttcaacagcaccatctcca
tctgatagccagattgcaagttcacaaaaaacccccatccaagctttggcaagaccacca
tctatggcttcttccccctcgatgcctttacagcaaactccgccaaatgtatctgctcca
cttaggccccctcaacataggccacatccaagaccataccatgctcctgcaatttcgcac
ccacagaatgcacttttaacacagcagcagcaaaaactaccacaacatcaacatttgcag
caacagcagcagcagcagcagcagcaacaaaaactacagcaacagcagcagcagcagcaa
caaaaactacagcagcagcagcagcagcagcaacaaaagctacagcagcagcagcagcaa
caacaaaatcagccacaacattcctcgcagcaaagtcaacagactacaacactcagaaac
cagcaacaaatttctcagcagcaaactgctcgtacccctgtctcaatggctcagaagcta
gattctcctgctgtactaaaagctactaatgtgcaatctggagacatggcttcagtcgat
gtggatgctggaggatctggtaatcgactgctttccaagaggagtatacatgaattagtt
gcacagattgatccttcagaaaagcttgatcctgaagttgaagatgttcttattgacatt
gcagaagattttgttgaatctgttgcaacatttgcttgttctttagcaaaacatagaaag
tcaagcattttagaagcaaaagatgtactcctccatgcagagagaagctggaatattacc
ttgccaggcttcagtggagatgaaataaaactgtacaagaagccgcatgtcaatgatatt
cacagggagaggcttactctgatcaagaagtcaatggccagcgaaagtaacgcaaagggc
tctgctgcgcaagctgcagctaaccagaaaaatcagacacccaagccacctgccacaggc
tctccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327470
Entry
4327470           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 12b isoform X1
  KO
K03126  transcription initiation factor TFIID subunit 12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4327470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4327470
   03036 Chromosome and associated proteins [BR:osa03036]
    4327470
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4327470
   Coactivators
    SAGA/TFTC/STAGA complex
     4327470
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     4327470
    STAGA complex
     4327470
    TFTC complex
     4327470
    SAGA complex
     4327470
    SLIK complex
     4327470
SSDB
Motif
Pfam: TFIID_20kDa CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 4327470
NCBI-ProteinID: XP_015618211
LinkDB
Position
1:complement(36385638..36390627)
AA seq 611 aa
MIPWGQPGSDPKDSNHPPPDSTTKRLRAHVKLPHRTRTCPRTPRRNRPPRVVSGRRPPPP
EPRRPQPAMADPPSAAATASPQPDQLAAAAVSTPQNPNPNPLLSPQIPPSPTVSDLSAIS
SPQLDPSAAGGGAMDYPPRPPQMQAPSPGQAAAGAGGFGQIHRSGSGSRLAAVGQLPQYA
AAAARMYGSQVNFSGGGGQVGQQQQQQQQLAARAAMLSQGQIGMLQGQGNAASAAHYGLQ
SQMMAQPRQKGMVQGAQFNTANAAQALQGMQSMGVMGGMRGNGTIPYNQQRFAHAQAQLR
PQQTSQQGTLSPQKVVGQGLTRTASIAALNPQLPGSSTNGPMAQMSLPQKQQQAAWLKQM
QSSLGSPVSPQQFQHQQRMLLIHQLQQQSGLNQHQIAQTQQQHPHLNTQLLQQQHILQQL
QQQQQSPRISASGSQKSMNLTGSQPGTPLSGGTMTGGSASQGAEVTNQLLGKRKIQDLVS
QVDPLGKVDPEVEDLLLEIADDFIDSVTAFACTLAKHRKSSVLEAKDVLLHLEKNWHLSV
PGFLREDKNPQRHPVKVSVDPQQPECDAAGIRSTGNKLVINNSVANHQTRPPVTEPSPMP
TMGPLSKVPRF
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgatcccgtggggccaacctggcagtgaccctaaagacagcaaccacccccctcctgac
tcaaccacgaaaagactacgcgcacacgtcaaactaccccacaggacccgtacctgcccc
cgcaccccccgacgcaatcgtccaccccgcgtcgtctccggccgccgcccaccgccgccg
gagccccgccgcccccagcccgccatggcggatccgccgtccgcggccgccaccgcctcg
ccgcagcccgatcagctcgccgccgccgccgtctccaccccgcaaaaccccaaccctaac
cccctcctctccccccaaatcccaccgtcgcccaccgtctccgacctgtccgccatctcg
tccccgcagctcgacccgtccgcggcgggcggcggggccatggactaccccccgcggccg
ccgcagatgcaggctccttcgcccggccaggcggcggccggggctggaggcttcggccag
atccaccgctcgggctcgggctcccgcctcgccgctgtcggccagcttccacagtacgct
gctgctgcggccaggatgtacggcagtcaggtgaacttctcgggaggtggaggacaggtg
ggacaacagcagcagcagcagcagcagctggctgctcgcgcggccatgcttagtcaaggc
cagattgggatgctgcaagggcaggggaacgcagcatctgcggcgcactatggtctccag
tcacagatgatggcgcagccaaggcagaagggtatggtgcaaggtgcacaatttaatact
gccaatgcagctcaagcattacaaggtatgcagtccatgggagtcatgggtggtatgaga
ggaaatggaactattccatataatcagcaacgttttgcccatgcacaagcacaattgagg
ccgcagcagacatcacagcaaggcacactgtctccacagaaggttgtgggtcaaggcttg
acaagaacagcatcgattgctgcattaaatccacagctacctggatcgtcgacaaatggg
ccgatggcacaaatgtcccttcctcagaaacagcagcaggcagcatggttaaaacaaatg
caatcatcgctgggatcacctgtttctccacaacaatttcagcatcaacaaaggatgcta
ttaatacatcaacttcaacagcagtcaggattgaatcaacaccaaatcgcacaaacccaa
caacagcatcctcatctcaatacccagcttttacagcagcaacacattctacagcaactt
cagcaacaacaacaatctccaaggatatcagcatctggttcccagaagtccatgaacctg
acaggatcacaaccgggcactcctttatcaggtggaactatgactggtggaagtgcaagt
caaggagcagaagtaactaatcaacttcttgggaagagaaaaatacaagatttggtttca
caggtagatcccctgggcaaggttgatccagaagtggaagatttgcttttggagattgct
gatgacttcattgattcggtgactgcatttgcgtgtacccttgcgaagcataggaaatca
tcagtcctggaagccaaggatgtattgctgcacctagaaaaaaattggcacttatctgtt
cctggtttcttaagggaggacaagaatccgcaaagacatcctgtaaaggtatcagtggac
cctcaacaaccagaatgtgatgctgctggtattagaagcacaggaaataaattggtaatt
aacaattcagttgccaaccatcaaacaagacctccggttactgagccttcaccaatgccc
acaatggggcctctgtcaaaagtgccccgtttctaa

DBGET integrated database retrieval system