KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325065
Entry
4325065           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L10a
  KO
K02865  large subunit ribosomal protein L10Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325065
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4325065
SSDB
Motif
Pfam: Ribosomal_L1 2Fe-2S_thioredx DUF3671
Other DBs
NCBI-GeneID: 4325065
NCBI-ProteinID: XP_015650848
UniProt: B7F9R7
LinkDB
Position
1:37231559..37234652
AA seq 216 aa
MSKLQSDALREAISQITSESREKQRKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KMKVCMLGDAQHVEEAEKMGLDYMDVEALKKMNKNKKLVKKLAKKYHAFLASEAIIKQIP
RLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNCAMEEKQIFQ
NVQMSVNFLVSLLKKNWQNVRCLYLKSTMGKVIRVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtaagttgcagagtgatgctcttagggaggcaatctcacaaattactagtgaatcc
cgcgagaagcagcgcaagttcgtggaaaccattgaactgcagattggactgaagaactat
gaccctcaaaaggataagcgtttcagtggatctgttaagttgcctcacatcccccgccct
aagatgaaggtgtgcatgcttggtgatgcccagcatgttgaagaggcagagaaaatgggc
ctagactatatggatgtggaagctctcaagaagatgaacaaaaacaagaagctggttaag
aagcttgcaaagaaatatcacgctttccttgcatctgaggccatcattaagcagattcct
cgacttcttggacctggtcttaacaaggcaggcaaattcccaacgttggtgactcaccag
gaatcacttgagtccaaggttaacgagactaaggctacagtgaagttccaactgaaaaag
gttctttgcatgggtgttgctgtaggcaactgtgctatggaggagaagcaaattttccaa
aatgtgcaaatgagcgtgaacttccttgtctctcttttgaagaagaattggcagaacgtg
agatgcttgtacctgaagagcactatgggaaaagtgatccgggtgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329171
Entry
4329171           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L10a
  KO
K02865  large subunit ribosomal protein L10Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329171
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4329171
SSDB
Motif
Pfam: Ribosomal_L1 2Fe-2S_thioredx DUF3671
Other DBs
NCBI-GeneID: 4329171
NCBI-ProteinID: XP_015627347
UniProt: Q6ER67 A0A0N7KF69
LinkDB
Position
2:12869382..12872340
AA seq 216 aa
MSKLQSDALREAISQIANDSREKQRKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KLKVCMLGDAQHVEEAEKMGLDYMDVEALKKMNKNKKLVKKLAKKYHAFLASEAIIKQIP
RLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNCAMEEKQIFQ
NVQMSVNFLVSLLKKNWQNVRCLYLKSTMGKVYRVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtaagttgcagagtgatgctctgagagaagcgatctctcaaattgctaatgactct
cgtgagaagcagcgcaaatttgtggaaaccattgagctgcagattggactgaagaactat
gaccctcaaaaggataagcgtttcagtggttctgttaagctgccccacatccctcggcct
aagttgaaggtttgcatgcttggtgatgctcagcacgtcgaagaggcagagaaaatgggc
ctagactatatggatgtggaagccctcaagaaaatgaacaaaaacaagaagctagttaag
aagcttgcaaagaaatatcatgctttccttgcttctgaggctatcatcaagcagattcct
cgacttcttggtcctggtcttaacaaagcaggcaaattcccaactctggtgacgcatcag
gaatcacttgagtccaaggttaatgagactaaggctacagtgaaattccagctgaagaag
gttctctgcatgggtgttgctgttggcaactgtgctatggaggagaagcagatcttccaa
aatgtgcagatgagcgtgaacttccttgtttcccttttgaagaagaattggcagaacgtt
aggtgcttgtacctgaagagcaccatgggaaaggtgtaccgagtgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266191
Entry
9266191           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L10a
  KO
K02865  large subunit ribosomal protein L10Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9266191
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9266191
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9266191
SSDB
Motif
Pfam: Ribosomal_L1 DUF3671
Other DBs
NCBI-GeneID: 9266191
NCBI-ProteinID: XP_015649389
UniProt: B7F845
LinkDB
Position
8:27963131..27965477
AA seq 216 aa
MSKLQSEVLKEAISQVVGESKEKGRKFTETVELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KMKVCMLGDAQHVEEAEKIGLDYMDVEALKKMNKNKKLVKKLAKKYHAFLASEAIIKQIP
RLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIQQ
NIQMSVNFLVSLLKKNWQNVRCLYIKSTMGKPIRVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtaagttgcagagcgaggttctcaaggaagccatctcccaggttgttggggaatcc
aaggagaagggcaggaagttcaccgagaccgttgagcttcagattggtctcaagaactat
gacccgcaaaaggacaagcgtttcagcggctccgtcaagctgccccatatcccccgcccc
aagatgaaggtctgcatgcttggtgatgcccagcatgtcgaggaggctgagaagattggg
cttgactacatggatgttgaggctcttaagaaaatgaacaagaacaagaagctggttaag
aagcttgccaagaagtaccatgctttcttagcatcagaggccatcatcaagcagattcct
cgtctccttggtcctggtctcaacaaggcaggcaagttccctacattggttactcaccag
gagtctcttgaatccaaggtcaacgagacgaaagctacagtcaagttccagctgaagaag
gttctgtgcatgggtgttgctgtgggtaacttgtcaatggaggagaagcagatccagcaa
aacatccaaatgagcgtcaacttcctcgtgtcccttttgaaaaagaactggcagaatgtg
aggtgcctttacatcaagagcaccatggggaaaccaatcagggtgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268245
Entry
9268245           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L10a
  KO
K02865  large subunit ribosomal protein L10Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9268245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9268245
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9268245
SSDB
Motif
Pfam: Ribosomal_L1 DUF3671
Other DBs
NCBI-GeneID: 9268245
NCBI-ProteinID: XP_015650483
UniProt: B7E6I4 Q6ZJ04
LinkDB
Position
8:27929300..27931731
AA seq 216 aa
MSKLQTEALKEAISQVVADCKEKNRKFTETVELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KMKVCMLGDAQHVEEAEKIGLDYMDVEALKKMNKNKKLVKKLAKKYHAFLASEAIIKQIP
RLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIQQ
NIQMSVNFLVSLLKKNWQNVRCLYIKSTMGKPYRVF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtaagttacaaaccgaggctctcaaggaagccatctcccaggttgttgctgattgc
aaggaaaagaacaggaagttcaccgagaccgttgagcttcaaattggtctcaagaactat
gacccacaaaaggacaagcgtttcagcggctccgttaagctgccccatatcccccgcccc
aagatgaaggtctgcatgcttggtgatgcccagcatgtcgaggaggctgagaagattggg
ctcgactacatggatgttgaggcccttaagaagatgaacaagaacaagaagcttgtgaag
aagcttgccaagaagtaccatgctttcttagcatcagaggccatcatcaagcagatcccc
cgtctccttggtcctggtctaaacaaggcaggcaagttccctacattggttactcaccag
gagtctcttgaatccaaggtcaatgagacgaaagctacagtcaagttccagctgaagaag
gttctgtgcatgggtgttgctgtgggtaacttgtcgatggaggagaagcagatccagcaa
aacatccaaatgagcgtcaacttcctcgtgtcccttttgaagaagaactggcagaatgtg
aggtgcctgtacatcaaaagcacaatggggaaaccgtacagggtgttctaa

DBGET integrated database retrieval system