KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325071
Entry
4325071           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4325071
   00030 Pentose phosphate pathway
    4325071
   00051 Fructose and mannose metabolism
    4325071
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325071
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4325071
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4325071
SSDB
Motif
Pfam: FBPase FBPase_C zf_CCCH_4
Other DBs
NCBI-GeneID: 4325071
NCBI-ProteinID: XP_015641461
UniProt: Q0JHF8
LinkDB
Position
1:37519487..37522458
AA seq 339 aa
MDHEADAYRTDLMTITRYVLNEQSRNPEARGDLTILLSHIVLGCKFVASAVNKAGLAKLI
GLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEEDEEATFVDPALRGKYCVCF
DPLDGSSNIDCGVSIGTIFGIYMIKDKENVTLEDVLQPGKNMVAAGYCMYGSSCTLVLST
GNGVNGFTLDPSLGEFILTHPDIKIPKKGKIYSVNEGNAKNWDEPTAKFVEKCKFPKDGS
SPKSLRYIGSMVADVHRTLLYGGVFLYPADKKSPNGKLRVLYEVFPMSFLMEQAGGQSFT
GKERALDLVPTKIHERSPIFLGSFEDVEEIKGLYAAQAK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggatcacgaggcggacgcgtaccggacggacctgatgacgatcacgcggtacgtgctg
aacgagcagagccgcaacccggaggcacgcggcgacctcaccatcctcctctcccacatc
gtgcttggctgcaagttcgtcgcctccgccgtcaacaaggccgggctcgccaagctcatc
gggctggccggcgagaccaacgttcagggagaggagcagaagaagctggacgtgctgtcc
aacgaggtgttcgtcaaggctctcgtcagcagcggccgcacctgcgttcttgtctccgag
gaggacgaggaagcgacgttcgtggaccctgcgctgcgtgggaagtattgcgtgtgcttt
gatccactcgacggctcctccaacatcgactgtggcgtctccatcggaacgatctttggg
atctacatgatcaaagataaggagaatgtgactcttgaggacgtgttacagcctggaaaa
aacatggttgctgctggatactgcatgtacggcagttcctgcacgcttgttctgagtact
ggaaatggtgtcaatggcttcacacttgatccatctctcggggagttcatattaactcat
ccagacatcaagataccaaagaaagggaagatttattcagtgaatgaagggaatgcgaaa
aattgggacgagcctaccgcaaagtttgtggagaagtgcaagttccctaaggatggttca
tcacctaaatccttgagatacattggaagtatggttgctgatgtccaccgtacgttgcta
tatggaggagtatttttgtaccctgcagacaagaagagcccaaatggaaaactccgtgtt
ctgtatgaagttttccccatgtcattcctgatggagcaggctggaggccagtctttcaca
ggcaaagaacgggctcttgacctcgttcctaccaagattcacgagagatccccaatattt
cttggaagcttcgaagatgtggaggagatcaaagggttgtacgctgcacaggcgaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332364
Entry
4332364           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332364
   00030 Pentose phosphate pathway
    4332364
   00051 Fructose and mannose metabolism
    4332364
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4332364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4332364
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4332364
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4332364
SSDB
Motif
Pfam: FBPase FBPase_C tRNA_NucTransf2
Other DBs
NCBI-GeneID: 4332364
NCBI-ProteinID: XP_015632363
UniProt: O64422
LinkDB
Position
3:complement(8841304..8843064)
AA seq 406 aa
MAAAATTSSHLLLLSRQQAAASLQCGLSFRRQPGRLAGGSSAPSVRCMAAVDTASAPAAT
EASKKSSYEITTLTTWLLKQEQAGTIDGEMTIVLASISTACKQIASLVQRAPISNLTGVQ
GAVNVQGEDQKKLDVVSNEVFSNCLKSSGRTGVIASEEEDVPVAVEESYSGNYIVVFDPL
DGSSNIDAAVSTGSIFGIYSPNDECLADIADDQNLDQVEQRCIVSVCQPGSNLLAAGYCM
YSSSVIFVLTIGTGVYVFTLDPMYGEFVLTQEKVQIPKAGKIYAFNEGNYALWDDKLKSY
MDSLKEPGPSGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSF
IVEQAGGKGSDGHQRILDIMPTEIHQRVPLYIGSVEEVEKVEKFLA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggccgccgcagccacgacatcctcccacctgctcctgctctcccgccagcaggcggcg
gcctcgctccaatgcggcctctccttccggaggcagcccggcaggctcgccggtgggtcg
tcggccccgagcgtgcggtgcatggcggccgtcgacacggcctcggcgcccgccgcgacg
gaggctagcaagaagagcagctacgagatcaccacgctgacgacgtggctgctgaagcag
gagcaggccgggaccatcgacggcgagatgaccatcgtgctggccagcatctccacggcg
tgcaagcagatcgcctcgctggtgcagcgcgcgcccatctccaacctcaccggcgtccag
ggcgccgtcaacgtgcagggcgaggaccagaaaaaactcgacgtcgtctccaacgaggtg
ttctccaactgcctcaaatcgagcgggcgcaccggcgtgatcgcgtcggaggaggaggac
gtgccggtggccgtggaggagagctactcgggcaactacatcgtggtgttcgacccgctc
gacggctcctccaacatcgacgccgccgtctccaccggctccatcttcggcatctacagc
cccaacgacgagtgcctagccgacatcgccgacgaccaaaatcttgaccaggtggagcag
aggtgcatcgtgagcgtgtgccagccggggagcaacctgctcgccgccggctactgcatg
tactcgagctcggtcatcttcgtgctcaccatcgggacaggggtgtacgtgttcacgctg
gacccgatgtacggcgagttcgtgctgacgcaggagaaggtgcagatccccaaggcaggc
aagatctatgccttcaacgagggcaactacgcgctctgggacgacaagctcaagagctac
atggacagcctcaaggagcccgggccgtccgggaagccatactccgcgcgctacatcggc
agcctcgtcggcgacttccaccgcacgctgctctacggcggcatctacggctaccccagg
gaccagaagagcaagaacggcaagctgcggctgctgtacgagtgcgcgccgatgagcttc
atcgtcgagcaggccggcggcaagggctccgatggccaccagaggatacttgacatcatg
cctacggagatccatcagagagtgccgctgtacatcgggagcgtggaggaagtggagaag
gtcgagaagttcttggcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338912
Entry
4338912           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338912
   00030 Pentose phosphate pathway
    4338912
   00051 Fructose and mannose metabolism
    4338912
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338912
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4338912
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4338912
SSDB
Motif
Pfam: FBPase FBPase_C zf_CCCH_4
Other DBs
NCBI-GeneID: 4338912
NCBI-ProteinID: XP_015640172
UniProt: A7J2C3
LinkDB
Position
5:complement(21493904..21496845)
AA seq 341 aa
MDHAAEAQRTDLMTITRHVLNEQGRHPESRGDFTILLSHIVLGCKFVASAVNKAGLAKLI
GLAGDTNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEENEEAIIVDAPLRGKYCVCF
DPLDGSSNIDCGVSIGTIFGIYMIKDKDNVTLDDVLQPGTDMLAAGYCMYGSSCTLVLST
GNGVNGFTLDPSLGEFILTHPNIKIPNRGKIYSVNEGNAKNWDAPTAKFVEKCKFPQDGS
PSKSLRYIGSMVADVHRTLLYGGIFLYPADQKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKQRALELVPRKIHDRSPIFLGSYDDVEDIKALYASESIIG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggatcacgcggcggaggcgcagaggacggacctgatgacgatcacgcggcacgtgctg
aacgagcagggccggcacccggagtcgcggggggacttcaccatcctactctcccacatc
gtcctcggctgcaagttcgtcgcctccgccgtcaacaaggccggcctcgccaagctcatc
ggcctcgccggcgacaccaacgtccagggtgaggagcagaagaagcttgacgtgctctcc
aacgaagtcttcgtcaaggcgctcgtcagcagcggccgcacgtgtgttcttgtgtctgaa
gagaacgaggaggccattatcgtcgacgctcccctccgcggaaagtattgcgtttgtttt
gatccactggatggctcctcaaatatcgattgtggtgtctccatcgggacgatctttggg
atttacatgattaaagacaaggacaacgtgactttggacgatgtactgcaacctggaaca
gacatgcttgctgctggctactgcatgtacgggagttcatgcacgcttgtgttgagcact
ggaaatggagtaaacggtttcacccttgatccttcccttggggagttcattctgactcat
ccaaacatcaagataccaaatagaggaaagatctattcagtgaacgaagggaatgcgaaa
aattgggatgctcctacagcgaagtttgtggagaaatgtaaatttccccaggatggttcg
ccttctaaatccttgagatacatcggaagtatggttgctgatgtccaccgtactttgcta
tatggaggcatatttttgtaccctgcggatcagaagagcccaaacggaaaacttcgtgtt
ctgtacgaagtgttcccaatgtcattcttgatggagcaagctggaggacaagctttcaca
ggcaaacaacgggcccttgaacttgttcccagaaagattcatgatagatctccaatattc
ctggggagctatgatgacgtggaggatatcaaagcattgtacgcttcagagtctatcatc
ggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341770
Entry
4341770           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4341770
   00030 Pentose phosphate pathway
    4341770
   00051 Fructose and mannose metabolism
    4341770
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4341770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341770
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4341770
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4341770
SSDB
Motif
Pfam: FBPase_C FBPase Inositol_P CbeA_antitoxin
Other DBs
NCBI-GeneID: 4341770
NCBI-ProteinID: XP_015642873
UniProt: A0A0P0X080 Q655Y9
LinkDB
Position
6:complement(27428876..27431139)
AA seq 401 aa
MPLSSLSLLPLHRAPLPPTSNYPPPPPPSRALLLPLLRHSPLARRSPVSRARAVAADGMA
AATAAAETPPTLLEYMGQAGAADDLVVLVAHVQSACKRIAALVASPGNAELSRGKAGGGV
AVAAGRDAPKPLDELSNEIILSSLRRSGKVAVMASEENHLPIWVSNDSPYVVVTDPLDGS
RNIEVSIPTGTIFGIYNRLAELDHLPEEERAQLNSLQSGTHLVASGYVLYSSATIFCISF
GAGTHGFTLDHLTGEFVLTHPSIQIPPRGQIYSVNDARYFDWPEGLRKYIDTIRQGKGQH
PKKYSARYVCSLVADFHRTLIYGGVAMNPRDHLRLVYEANPLSFLAEQAGGRGSDGKSRI
LSIQPVKLHQRLPLFLGGMEDMLELESYGDVQQKVNPGYEV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgccgttatcctctctctccctcctccccctccaccgcgctccgctcccgccaacttca
aattacccgccaccgccgcctccctctcgcgccctcctcctccccctcctccgccactcg
ccgctcgcgcgccgctcgcccgtctcccgggcgcgtgccgtagcagccgacggcatggcc
gcggcgaccgcggcggcggagacgccgcccacgctgctcgagtacatgggccaggctggc
gcggccgacgacctcgtcgtcctcgtggcgcacgtccagagcgcgtgcaagcgcatcgcc
gcgctcgtggcgtcgcccgggaacgccgagctgtcgcgggggaaggcggggggtggtgtg
gcggtggcggccgggcgggacgcgcccaagccgctcgacgaattgtcgaatgagatcatc
ttgtcatcactccgaagatctggaaaggttgcagtgatggcttctgaagaaaatcatctc
cccatttgggtttccaacgacagcccgtatgttgttgttacggatccgcttgatggttct
cgcaacattgaggtatccattcccaccggaacaatatttgggatatacaataggctggca
gagcttgaccatctacctgaagaggagagagctcagctcaattcactgcaaagcggcact
caccttgtcgcttcggggtatgtgctgtattcatctgccaccatattctgtatcagcttc
ggtgcaggtacccatggcttcaccttggatcacttgactggagaatttgttctaacacat
ccttccatccaaatacccccaagaggacagatatattcggtgaatgatgcgcggtatttc
gactggcctgagggcctaaggaagtacattgacacgatcagacaaggcaagggacagcat
ccgaagaagtactcggcacggtacgtgtgctcgctggttgctgatttccaccggacgctg
atatacggtggagttgccatgaaccccagggatcaccttcggttggtctatgaagcaaat
cctctgagtttccttgctgagcaggcagggggcaggggttcagatggcaagagcagaatc
ctctcgattcagcctgtgaagctgcaccagaggctgccattgttcctgggaggcatggag
gacatgcttgagttggaaagctatggagatgtgcaacagaaggttaatcctggatatgag
gtgtga

DBGET integrated database retrieval system