KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325074
Entry
4325074           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM3A
  KO
K12622  U6 snRNA-associated Sm-like protein LSm3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4325074
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325074
   03041 Spliceosome [BR:osa03041]
    4325074
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4325074
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4325074
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4325074
 Complex C
  U2 snRNP components
    4325074
SSDB
Motif
Pfam: LSM TIG_SUH
Other DBs
NCBI-GeneID: 4325074
NCBI-ProteinID: XP_015641494
UniProt: Q5N9F1 A0A0P0VAW1
LinkDB
Position
1:complement(37527408..37529159)
AA seq 104 aa
MAAAAAAAAAEEEIAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVE
EIVTTVEIDDETYEEIVRTTKRTIPFLFVRGDGVILVSPPLRTA
NT seq 315 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcagcggcggctgaggaggagatcgcggtgaaggagccgctg
gatctgatcaggctcagcctcgacgagcgcatctacgtcaagctcaggtccgaccgcgag
ctccgcggcaagctccatgcatacgatcaacatttaaacatgattcttggagatgttgag
gagatcgtgacaacagttgagattgacgatgagacatatgaagaaattgtgcgcaccaca
aaacgcactatccccttcctttttgttcgaggtgatggtgtcattttggtttctccaccc
ctccgaacggcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326227
Entry
4326227           CDS       T01015                                 
Name
(RefSeq) probable U6 snRNA-associated Sm-like protein LSm4
  KO
K12623  U6 snRNA-associated Sm-like protein LSm4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326227
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4326227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326227
   03041 Spliceosome [BR:osa03041]
    4326227
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4326227
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4326227
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4326227
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4326227
NCBI-ProteinID: XP_015623140
UniProt: Q9LGE6
LinkDB
Position
1:complement(8570846..8574550)
AA seq 147 aa
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDKFWRMPECY
IRGNTIKYLRVPDEVIDKVQEETSKSRSDRRPPGVGRGRGRGDIGTKPGGRGIGRGQDDG
GSKGGGGRGRGGIGGKGGIKGGGRGRG
NT seq 444 nt   +upstreamnt  +downstreamnt
atgcttccgctctcgctcctcaagaccgcccaggggcatcccatgctcgtggagcttaag
aacggcgagacgtacaacgggcacttggtgaactgcgacacgtggatgaacatccacctc
cgggaggttatttgcacctcaaaggatggtgataagttttggaggatgccagaatgttac
atccgtgggaacaccatcaagtatcttcgggttcctgatgaggtgattgacaaggtccag
gaagagacttcaaagagcagatcagataggaggccaccaggtgtaggccgcggaagagga
agaggtgatataggtactaagcctggaggcagaggcattgggcgtggccaggatgatggt
ggcagcaaaggcggtggtggccgtggaaggggaggaattggaggtaaaggtggcatcaaa
ggtgggggccgcggacgtgggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329449
Entry
4329449           CDS       T01015                                 
Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329449
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329449
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329449
   03041 Spliceosome [BR:osa03041]
    4329449
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4329449
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4329449
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4329449
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4329449
NCBI-ProteinID: XP_015626012
UniProt: Q6K2E9 A0A8J8YI38
LinkDB
Position
2:complement(18231477..18235795)
AA seq 101 aa
MSSGGEKSGSGGGGGGGGGGAVKTPSDFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNI
AMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLTDGA
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagcagtggcggcgagaagtccggctcgggcggcggcggcggtggcggcggcggcggg
gcggtgaagacgccctccgacttcctcaagtccatcagggggcgccccgtcgtcgtcaag
ctcaactccggcgtcgactaccgcggtattttggcttgtcttgatggttacatgaacatt
gcaatggagcaaacggaagaatatgtcaatggtcagctgaagaacaagtacggtgacgct
ttcatacgaggaaacaatgttttatacatcagcacatcaaagcgtaccctcactgatggt
gcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335668
Entry
4335668           CDS       T01015                                 
Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4335668
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4335668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4335668
   03041 Spliceosome [BR:osa03041]
    4335668
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4335668
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4335668
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4335668
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4335668
NCBI-ProteinID: XP_015636054
UniProt: Q0JDN9 A0A8J8YDN3
LinkDB
Position
4:complement(19135172..19139385)
AA seq 97 aa
MSTGGGADKSGGGGGGAVKTPSDFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQ
TEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLTDDA
NT seq 294 nt   +upstreamnt  +downstreamnt
atgagcaccggcggcggcgcggacaagtccggcggcggcggcggaggggcggtgaagacg
ccctcggacttcctcaagtcgatcaggggacgccccgtcgtcgtcaagctcaactccggc
gtcgactaccgaggtattttggcttgcctggatgggtatatgaacattgcaatggagcaa
acggaagagtatgtgaatggccaactcaagaacaagtatggtgatgccttcataagaggc
aacaatgttctatacatcagcacttcgaagaggacccttacggatgacgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338670
Entry
4338670           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM5
  KO
K12624  U6 snRNA-associated Sm-like protein LSm5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338670
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4338670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4338670
   03041 Spliceosome [BR:osa03041]
    4338670
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4338670
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4338670
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4338670
SSDB
Motif
Pfam: LSM LSM14
Other DBs
NCBI-GeneID: 4338670
NCBI-ProteinID: XP_015637744
UniProt: Q60E54 B9F364
LinkDB
Position
5:complement(18838336..18840816)
AA seq 89 aa
MSQNNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLCGFDVYVNMVLEDVTEYEYTAEG
RRITKLDQILLNGNNIAILVPGGSPPDVA
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctcagaacaacccctcccagctcctcccctcagagctgattgaccgctgcatcggg
tccaagatttgggtgattatgaagggtgacaaggagctcgtcggcactctctgtgggttc
gatgtgtacgtcaacatggtgctcgaggacgttactgagtatgaatacactgctgaaggc
cgtcgcataacaaagcttgatcagatactcctaaacggcaacaatatagctattttggtt
cctggtggttctcccccagatgtggcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339810
Entry
4339810           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM8
  KO
K12627  U6 snRNA-associated Sm-like protein LSm8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4339810
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4339810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339810
   03041 Spliceosome [BR:osa03041]
    4339810
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4339810
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4339810
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4339810
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 4339810
NCBI-ProteinID: XP_015640148
UniProt: A0A0P0WRT3 Q5TKF9
LinkDB
Position
5:29623057..29625065
AA seq 99 aa
MASAGPGLESLVDQIISVITNDGRNIVGTLRGFDQATNIILDESHERVYSTREGVQQLVL
GLYIIRGDNISVVGEVDEELDARLDLSNLRAHPLKPVIH
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcgtccgccggcccggggctcgaatcgctcgtcgaccagatcatatccgtcatcaca
aacgatggccgcaacattgtggggacactcagaggattcgatcaagccaccaacatcatc
ctcgatgagtcccatgagagggtctattctaccagggagggagtgcaacagcttgttctt
gggttgtacatcataaggggcgacaacatcagcgtggtgggggaggtggatgaagaactg
gatgcgaggctggatctatcgaatctgagagcgcacccgctgaagcccgtgatccactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344686
Entry
4344686           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM2
  KO
K12621  U6 snRNA-associated Sm-like protein LSm2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344686
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4344686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344686
   03041 Spliceosome [BR:osa03041]
    4344686
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4344686
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4344686
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4344686
 Complex C
  U2 snRNP components
    4344686
SSDB
Motif
Pfam: LSM SM-ATX LSM14 DUF1256 DUF150_C
Other DBs
NCBI-GeneID: 4344686
NCBI-ProteinID: XP_015650113
UniProt: Q0J7Y5 A0A0P0XBT0
LinkDB
Position
8:3146467..3150040
AA seq 93 aa
MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC
FIRGSVVRYVLLPQDGVDIDILHDATRREARGG
NT seq 282 nt   +upstreamnt  +downstreamnt
atgctgttcttctcctacttcaaggagctcgtggggaaggaggtgacggtggagctcaag
aacgacctggccatccgcggcacgctccactccgtcgaccaatacctcaacatcaagctc
gagaacactcgggttgtcgaccaggacaagtacccgcacatgctatccgtgcgaaactgc
ttcatcaggggatcggtggtgcggtacgtgctgcttccccaggatggcgtcgacattgac
atcctccatgatgccaccaggagggaggctcgcggaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344803
Entry
4344803           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM7
  KO
K12626  U6 snRNA-associated Sm-like protein LSm7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344803
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4344803
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344803
   03041 Spliceosome [BR:osa03041]
    4344803
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4344803
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4344803
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4344803
SSDB
Motif
Pfam: LSM DUF150_C Hfq
Other DBs
NCBI-GeneID: 4344803
NCBI-ProteinID: XP_015649738
UniProt: Q6ZBS1
LinkDB
Position
8:4562429..4565371
AA seq 98 aa
MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFEREQDDPLKL
SGKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFQSDGA
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtcggggcgcaaggagacggtgctggacctggccaagttcgtcgacaagggcgtccag
gtcaagctcaccggcggcaggcaagttacagggactttgaagggctatgaccagcttcta
aacttggtgcttgatgaagcggttgaatttgaaagagagcaagatgatccattgaaacta
tcagggaaaaccagacagcttggtcttattgtctgtaggggtacagcggtgatgcttgta
tcgccaaccgatggaacggacgagattgccaaccccttccaatctgatggtgcataa

DBGET integrated database retrieval system