KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325100
Entry
4325100           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L5-1
  KO
K02932  large subunit ribosomal protein L5e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4325100
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325100
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4325100
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4325100
SSDB
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c
Other DBs
NCBI-GeneID: 4325100
NCBI-ProteinID: XP_015614994
UniProt: Q0JGY1 B7EWY9
LinkDB
Position
1:38973598..38976400
AA seq 304 aa
MGGFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKD
ITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEY
EGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF
AGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALY
KKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAGADDDDEE
EDDE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgggagggtttgtcaagacccagaagaccaatgcctaccacaagcgtttccaagtcaag
ttcaagagacggaggcagggcaagactgactacagggccaggattaggctcaccaaccaa
gataagaacaagtacaacacaccgaagtaccgcttcgttgtgagatttacaaacaaagat
atcacagctcaaattgtctatgctaccattgctggtgatatcgtgatggctgctgcctac
tcccatgagctgcctcgctatggtcttgaagttggtctcaccaactatgcggcagcttat
tgcactggcttgcttttggctcgccgtgtgctcaagctccgtggtttggaccaggagtac
gagggcaatattgaggccactggggaggactactatgttgaaccagctgatgaaaggcgg
cctttccgtgctctcttggatgttggcctcattaggacaaccactggaaaccgtgtcttt
ggtgccctcaagggagctttggatggtggtcttgacattcctcacagtgacaagaggttt
gctgggttcaagaaggacgagaagcagcttgattctgatattcaccgcaagtacatctac
ggtgggcacgtggctgactacatgaggtctatggcggaggaggaacctgagaaattccaa
gcccacttcagtgagtacctcaagaagggaattgatgctgatggcatggaagcactgtac
aagaaggtccatgctgccatccgtgctgatcctaccatggccaaatcaaccaagaaggaa
ccggcgacccacaagagatacaacctcaagaagctaacctacgaacagaggaaggccagt
cttgtcgaaagattgaatgctctcaactcctctgctggtgctgatgatgatgacgaggaa
gaggatgatgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271934
Entry
9271934           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L5-1
  KO
K02932  large subunit ribosomal protein L5e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    9271934
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271934
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9271934
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9271934
SSDB
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c
Other DBs
NCBI-GeneID: 9271934
NCBI-ProteinID: XP_015614983
UniProt: Q8L4L4
LinkDB
Position
1:38968256..38971061
AA seq 304 aa
MGGFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKD
ITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEY
EGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRF
AGFKKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLY
KKVHAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAGADDDDEE
EDDE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgggagggtttgtcaagacccagaagacccatgcctacttcaagcgattccaagtcaag
ttcaagagacggaggcagggcaagactgactacagggccaggattaggctcaccaaccaa
gataagaacaagtacaacacaccgaagtaccgcttcgttgtgagatttacaaacaaagat
atcacagctcaaattgtctatgctaccattgcgggtgatatcgtgatggctgctgcctac
tcccatgagctgcctcgttatggtcttgaagttggtctcaccaactatgcggcagcttac
tgcactggcttgcttctggctcgtcgtgtgctcacgctccgtggtttggaccaggagtac
gagggcaatgttgaggccactggggaggactactatgttgaaccagctgatgaaaggagg
cctttccgtgctctcttggatgttggcctcattaggacaaccactggaaaccgtgtcttt
ggtgccctcaagggagctttggatggtggtcttgacattcctcacagtgacaagaggttt
gctgggttcaagaaggacgagaagcagcttgattctgatattcaccgcaagtacatctac
ggtgggcacgtggctgactacatgaggtctatggctgaggaggaacctgagaaattccaa
gcccactttagtgagtacctcaagaagggaattgacgctgatggcatggaatcactgtac
aagaaggtccatgctgccatccgcgccgatcctaccatggccaaatcgaccaagaaggaa
ccggctacccacaagagatacaacctcaagaagctgacctacgagcagaggaaggccagt
ctcgtcgaaagattgaatgctctcaactcctccgctggtgctgatgatgatgacgaggaa
gaggatgacgagtga

DBGET integrated database retrieval system