KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325130
Entry
4325130           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein At4g28440
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Other DBs
NCBI-GeneID: 4325130
NCBI-ProteinID: XP_015621971
UniProt: Q5JML8 Q0JJ87
LinkDB
Position
1:complement(31638604..31640497)
AA seq 140 aa
MAAAAAAAKRKPVFVKVDQLKPGTGGHTLVAKVLSSKTVVQKGRAAAGAGPAARPTRIAE
CLIGDETGCILFTARNEQVDLMKADSTVIIRNAKIDMFKGSMRLAVDKWGRIEVTEPASF
NVKEDNNLSLVEYELVNVEG
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcgaagaggaagccggtgttcgtcaaggtggaccagctc
aagcccggcacgggcggccacacgctcgtcgccaaggtgctcagctccaagaccgtggtc
cagaagggccgcgccgccgcgggagcgggcccggcggcgcgtcccacgaggatcgccgag
tgcctcatcggcgacgagaccggctgcatcctgttcaccgcccgcaacgagcaggttgac
ctgatgaaggctgacagcactgttattatccgcaatgcaaaaattgatatgttcaaagga
tcaatgaggcttgctgtggacaaatggggccgcattgaagtgactgaaccggcaagtttc
aacgtaaaggaggataacaatctctcacttgtggagtatgaacttgtcaatgttgaaggg
tga

DBGET integrated database retrieval system