KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325155
Entry
4325155           CDS       T01015                                 
Name
(RefSeq) putative L-cysteine desulfhydrase 1 isoform X1
  KO
K22207  L-cysteine desulfhydrase [EC:4.4.1.28]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4325155
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.28  L-cysteine desulfidase
     4325155
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-GeneID: 4325155
NCBI-ProteinID: XP_015613237
UniProt: Q9LGZ2
LinkDB
Position
1:complement(10496841..10500938)
AA seq 482 aa
MASIPPDDDAAAAAAAGAAENGYGNGKGNGNGPAPRPPPAKRPRSVISAAQIRAEFEHHE
AGVARVNNGSFGCCPSSLLDAQARWQRLFIAQPDDFYFHALQPGLRRSRAAVAGLVNAGD
VAEVSLVDNATTAAAIVLQHAAWSFAEGRFSRGDAVLMLHYAYGAVKKSIHAYVARAGAT
VVEVPLPFPVASADAIIAEFRAALDVAKAGGRKVRLAVIDHITSMPSVVIPVKELVAICR
EEGVDKVFIDAAHSIGQVPVDVRDIGADFYTSNLHKWFFCPPAVAFLHTRKDDPIASQLH
HPVVSHEYGNGLPMESGWIGTRDYSAQLVVPESIDFVNRFEGGIEGIRSRNHEKVIEMGK
MLAEAWGTFLGTPPELCGSMVMVGLPGCLGVESDDDVMRMRTMLRKDFMVEVPIYYNSRR
VEAQEMAKDKNGDAVTGYVRISHQVYNVTEDYEKLRDAVNKLVADGFTSSKLRPSQKQET
MA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgtcgatcccgccggatgacgacgcggcggcggcggcggcggcgggggcggccgag
aacgggtacgggaacgggaaggggaacggcaacgggccggcgccgcgcccgccgccggcg
aagcggccgaggtcggtgatctcggcggcgcagatccgggcggagttcgagcaccacgag
gccggggtggcgcgcgtcaacaacggcagcttcgggtgctgcccgtcctccctcctcgac
gcgcaggcgcggtggcagcgcctcttcatcgcccagcccgacgacttctacttccacgcc
ctccagccggggctccgccgctcgcgggctgccgtcgcgggcctcgtcaacgccggggac
gtcgccgaggtctccctcgtcgacaacgccaccaccgccgccgccatcgtgctgcagcac
gccgcgtggagcttcgccgaggggaggttctcccgcggggacgccgtgctcatgctccac
tacgcgtacggcgccgtcaagaagtccatccacgcctacgtcgcccgcgccggggccacc
gtcgtcgaggtgccgctcccgttccccgtcgcgtccgcggacgccatcatcgccgagttc
cgcgccgcgctcgatgtggccaaggccggggggcgcaaggtccgcctcgcggtcatcgac
cacatcacctccatgcctagcgttgtcatcccggtgaaggagctcgttgccatctgccga
gaagagggtgtcgataaggtgtttatagatgccgcgcactccattgggcaggtccctgtt
gatgtgcgcgatattggggccgatttttacaccagcaatctccacaagtggttcttctgc
ccgcctgccgtggctttcttgcacacccgaaaggatgatccgatagcctcccagctccac
catcctgtggtgtcgcacgagtacggcaatgggcttcccatggagagtggatggattggg
acaagggattacagtgcacagcttgtagtgcctgaatctattgattttgttaaccgattt
gaaggtggcatcgagggaataaggagccgtaaccatgaaaaagtgatcgagatgggtaag
atgcttgctgaggcatgggggacttttcttggcacaccaccagagctgtgcggtagcatg
gttatggttggtcttcccggttgccttggtgttgaaagtgatgatgatgtgatgagaatg
agaacaatgttgaggaaggattttatggtggaggtgccaatatactacaattcgagaaga
gtagaagctcaagaaatggcaaaggataagaatggtgatgcagtcacagggtatgttagg
atctcacaccaagtttacaatgtaacggaggattatgagaagctgagggatgctgtcaat
aagcttgttgctgatggattcaccagcagcaagttgcggccttcgcagaagcaggaaacg
atggcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325157
Entry
4325157           CDS       T01015                                 
Name
(RefSeq) putative L-cysteine desulfhydrase 2
  KO
K22207  L-cysteine desulfhydrase [EC:4.4.1.28]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4325157
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.28  L-cysteine desulfidase
     4325157
SSDB
Motif
Pfam: Aminotran_5 TSC22
Other DBs
NCBI-GeneID: 4325157
NCBI-ProteinID: XP_015625397
UniProt: Q5JNT6
LinkDB
Position
1:10508891..10513400
AA seq 479 aa
MASLQSGGDAAANGVDADVDGAASPPSAKRPRAGAGAAAITDAEVRAEFAHHDRAVARLN
NGTFGCCPASVLAARARWQRLFLSQPDAFYFHHLQPGLARSRAAVAAAVGAGDASEVSLV
DNVTTAAAIIMQHVAWSFAEGDFARGDVVLMFLYTYCSIKNSIHAYVARAGATVVEVPLP
FPVSSPDAIVAEFRAALAVARDGGRRRVRLAVIDHITAMPTVLIPVKELVAICREEGVDK
VFVDAAHAVGQVPVDVRDIGADFYASNLHKWFFCPSAVAFIHTRKDDPVSSKLHHPVVSS
EYGNGLPMESAWIGVRDYSAQLVVPDVVDFVNRFDGGVEGIRRRNHDKVVEMGTMLAAAW
GTFLGTPPEMCGSMLMVGLPGSLGVGSEDDAVGLRTMLRKQFKVEVPLYYNSKAAAADAP
PEMVKDGNGDPVTGYVRISHQVYNVREEYEALRDAVAKLVADGFTCRKLRPPEKEETLA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcctcgcttcagtccggcggcgacgcggccgcgaacggcgtcgacgccgacgtcgac
ggcgccgcgtccccgccctcggcgaagcggccccgcgcgggcgcgggcgcggcggcgatc
acggacgccgaggtccgggccgagttcgcgcaccacgaccgcgccgtggcgcgcctgaac
aacggcaccttcggctgctgcccggcgtcggtgctggcggcgcgggcgcggtggcagcgc
ctgttcctgtcgcagcccgacgcgttctacttccaccacctccagcccgggctcgcccgc
tcccgcgccgcggtcgccgcggccgtcggcgccggggacgcctccgaggtctccctcgtc
gacaacgtcaccacggccgccgccatcatcatgcagcacgtcgcctggagcttcgccgag
ggggacttcgcgcgcggggacgtcgtgctcatgttcctctacacctactgctccatcaag
aactccatccacgcgtacgtggcccgcgcgggcgccaccgtcgtcgaggtgcccctcccg
ttccccgtctcctccccggacgccatcgtcgccgagttccgcgcggcgctcgcggtggcc
agggacggcggtcgccgccgcgtccgcctcgccgtcatcgaccacatcaccgccatgccc
accgtcctcatcccggtcaaggagctcgtcgccatctgccgcgaggagggcgtcgacaag
gtgttcgtcgacgcggcgcacgccgtggggcaggtccccgtcgacgtgcgcgacatcggc
gccgacttctacgccagcaacctccacaagtggttcttctgcccctccgccgtcgccttc
atccacacgcgcaaggacgaccccgtctcctccaagctccaccaccccgtcgtctccagc
gagtacggcaacggcctccccatggagagcgcctggatcggggtgcgcgactacagcgcg
cagctcgtggtcccggacgtcgtcgacttcgtcaatcgcttcgacggcggcgtggagggg
atacgccgccggaaccacgacaaggtggtcgagatgggcacgatgctcgccgccgcgtgg
ggcacgttcctcggcacgccgccggagatgtgcgggagcatgctcatggtggggctgccc
ggctcgctgggcgtcgggagcgaggacgacgccgtcggcctgaggacgatgctgaggaag
cagttcaaggtggaggtgccgctctactacaactccaaggcggcggcggcggatgcgccg
ccggagatggtcaaggacggcaatggcgatccggtgacggggtacgtgaggatctcgcac
caggtgtacaacgtccgggaggaatacgaggcgctcagggacgcggtcgccaagctcgtc
gccgacggcttcacctgcagaaagttacggcctcctgagaaggaagaaactctggcatga

DBGET integrated database retrieval system