KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325163
Entry
4325163           CDS       T01015                                 
Name
(RefSeq) S-adenosylmethionine synthase 3
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00034  Methionine salvage pathway
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4325163
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4325163
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     4325163
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N MSA_2
Other DBs
NCBI-GeneID: 4325163
NCBI-ProteinID: XP_015614349
UniProt: Q9LGU6
LinkDB
Position
1:complement(10657465..10660151)
AA seq 396 aa
MAEVDTFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPESKVACETCTKTNMVMVFGEI
TTKANVDYEKIVRDTCRGIGFVSNDVGLDAEHCKVLVNIEQQSPDIAQGVHGHFTKRPEE
IGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGACAWLRPDGKTQVTVEYQ
NDNGAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEQYLDEKTIFHLNPSGR
FVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVANG
LARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILRIVTENFDFRPGMIIINLDLMRG
GNGRYLKTAAYGHFGREDPDFTWEVVKPLKWEEPSA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctgaggttgacaccttcctcttcacttccgagtccgtcaatgagggacaccctgac
aagctctgcgaccagatatccgatgcggtgcttgatgcgtgccttgctgaagaccctgaa
agcaaggttgcctgtgagacctgcaccaagaccaacatggtcatggtgtttggtgagatc
actaccaaggccaatgttgactatgagaagatcgtcagggatacttgccgcggcatcggc
tttgtgtccaatgatgtaggccttgatgctgaacactgtaaggtgcttgtcaacattgag
cagcaatcccctgacatcgcacagggtgtccatgggcacttcaccaagcgcccagaggag
attggtgccggtgaccaggggcatatgtttggatatgcaaccgatgagacccctgaattg
atgccactcagccatgttcttgctaccaagctcggtgcccgtctcaccgaggtccgcaag
aacggggcatgcgcatggctgaggcctgatgggaagacgcaagtgacagtggagtaccag
aacgacaatggcgccatggtccctctccgcgtccacaccgtgctcatctccacccagcac
gatgagaccgtgaccaacgacgaaatcgcggctgacctgaaggagcatgtcatcaagcct
gtcatcccagagcagtaccttgatgagaagaccatcttccatctcaacccgtcaggtcgc
ttcgtcatcggtggacctcatggagatgcaggtctcaccgggcgcaagatcatcatcgac
acctacggtggctggggagcacacggtggtggcgcgttctccggcaaggacccgaccaag
gttgaccggagcggagcctacattgcaaggcaggcggccaagagcatcgttgccaatggc
ctcgctcgccgctgcattgtccaggtgtcgtatgccattggcgtgccggaaccgctctcg
gtgttcgtcgacacttacggcacgggcaagatccctgacagggagatcctcaggattgtc
acggagaacttcgatttcaggccaggcatgatcatcatcaacctcgacctgatgaggggt
ggcaatggccgctacctgaagacggcggcttacgggcacttcgggagggaggaccctgac
ttcacctgggaggtggtgaaacccctcaagtgggaggagccttctgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326996
Entry
4326996           CDS       T01015                                 
Name
(RefSeq) S-adenosylmethionine synthase 2
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00034  Methionine salvage pathway
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4326996
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4326996
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     4326996
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N MSA_2
Other DBs
NCBI-GeneID: 4326996
NCBI-ProteinID: XP_015613529
UniProt: P93438 A0A0R7VIP9
LinkDB
Position
1:complement(12363849..12366350)
AA seq 394 aa
MAAETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEIT
TKATVDYEKIVRDTCRGIGFVSDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEI
GAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYLN
DAGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPDKYLDEKTIFHLNPSGRF
VIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGL
ARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGG
NRFIKTAAYGHFGREDPDFTWEVVKPLKYEKASS
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcggcggagacgttcctcttcacctccgagtccgtgaacgagggtcacccggacaag
ctgtgcgaccaggtgtcggacgcggtgctcgacgcgtgcctcgcccaggaccccgacagc
aaggtggcgtgcgagacgtgcaccaagaccaacatggtgatggtgttcggcgagatcacc
accaaggccaccgtcgactacgagaagatcgtccgcgacacctgccgcggcatcggcttc
gtgtccgacgacgtcggcctcgacgccgaccgctgcaaggtgctcgtcaacatcgagcag
cagtcgcccgacatcgcgcagggggtgcacggccacttcaccaagcgccccgaggagatc
ggcgccggcgaccagggccacatgttcggctacgccaccgacgagacccccgagctgatg
cccctcagccacgtcctcgccaccaagctcggcgcccgcctcaccgaggtccgcaagaac
ggcacctgcgcctggctcaggcccgacggcaagacccaggtcaccgttgagtacctcaac
gacgccggcgccatggtccccgtccgcgtccacaccgtcctcatctccacccagcacgac
gagaccgtcaccaacgacgagatcgccgccgacctcaaggagcacgtcatcaagccggtc
atccccgacaagtacctcgacgagaagaccatcttccacctcaacccctcgggccgcttc
gtcatcggcgggccccacggcgacgccggcctcaccggccgcaagatcatcatcgacacc
tacggcggatggggcgcgcacggcggcggcgccttctccggcaaggacccgaccaaggtc
gaccggagcggcgcctacatcgccaggcaggccgccaagagcatcgtcgccagcggcctc
gcccgccgctgcatcgtgcaggtgtcgtacgccatcggcgtccccgagccgctctccgtg
ttcgtcgactcctacggcaccggcaagatccccgacaaggagatcctcaagatcgtcaag
gagaacttcgatttcaggcccgggatgatgaccatcaacctcgacctcaagaggggcggc
aaccggttcatcaagaccgcggcgtacggccatttcggccgcgaggatcccgacttcaca
tgggaggttgtcaagccgctcaagtatgagaaggcatcttcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337733
Entry
4337733           CDS       T01015                                 
Name
(RefSeq) S-adenosylmethionine synthase 1
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
osa01240  Biosynthesis of cofactors
Module
osa_M00034  Methionine salvage pathway
osa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4337733
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4337733
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     4337733
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-GeneID: 4337733
NCBI-ProteinID: XP_015638780
UniProt: Q0DKY4 B7EKA4 A0A8J8Y8R6
LinkDB
Position
5:2088998..2091952
AA seq 396 aa
MAALDTFLFTSESVNEGHPDKLCDQVSDAVLDACLAEDPDSKVACETCTKTNMVMVFGEI
TTKANVDYEKIVRETCRNIGFVSADVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEE
IGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYR
NESGARVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEQYLDEKTIFHLNPSGR
FVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVARQAAKSIVASG
LARRCIVQVSYAIGVPEPLSVFVDTYGTGRIPDKEILKIVKENFDFRPGMIIINLDLKKG
GNGRYLKTAAYGHFGRDDPDFTWEVVKPLKWEKPSA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggccgcacttgataccttcctctttacctcggagtctgtgaacgagggccaccctgac
aagctctgcgaccaagtctcagatgctgtgcttgatgcctgcctcgccgaggaccctgac
agcaaggtcgcttgtgagacctgcaccaagacaaacatggtcatggtctttggtgagatc
accaccaaggctaacgttgactatgagaagattgtcagggagacatgccgtaacatcggt
tttgtgtcagctgatgtcggtctcgatgctgaccactgcaaggtgcttgtgaacatcgag
cagcagtcccctgacattgcacagggtgtgcacggccacttcaccaagcgccctgaggag
attggtgctggtgaccagggacacatgtttggatatgcaactgatgagacccctgagttg
atgcccctcagccatgtccttgctaccaagcttggcgctcgtcttacggaggttcgcaag
aatgggacctgcgcatggctcaggcctgacgggaagacccaagtgactgttgagtaccgc
aatgagagcggtgccagggtccctgtccgtgtccacaccgtcctcatctctacccagcat
gatgagacagtcaccaacgatgagattgctgctgacctgaaggagcatgtcatcaagcct
gtcattcccgagcagtaccttgatgagaagacaatcttccatcttaacccatctggtcgc
ttcgtcattggcggacctcatggtgatgctggtctcactggccggaagatcatcattgac
acttatggtggctggggagctcacggtggtggtgccttctctggcaaggacccaaccaag
gttgaccgcagtggagcatacgtcgcaaggcaagctgccaagagcattgttgctagtggc
cttgctcgccgctgcattgtccaagtatcatacgccatcggtgtcccagagccactgtcc
gtattcgtcgacacatacggcactggcaggatccctgacaaggagatcctcaagattgtg
aaggagaacttcgacttcaggcctggcatgatcatcatcaaccttgacctcaagaaaggc
ggcaacggacgctacctcaagacggcggcttacggtcacttcggaagggacgacccagac
ttcacctgggaggtggtgaagcccctcaagtgggagaagccttctgcctaa

DBGET integrated database retrieval system