KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325167
Entry
4325167           CDS       T01015                                 
Name
(RefSeq) glutamate--tRNA ligase, cytoplasmic
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4325167
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4325167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4325167
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4325167
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:osa02048]
    4325167
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     4325167
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4325167
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4325167
 Prokaryotic type
   Other AARSs
    4325167
Prokaryotic defense system [BR:osa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    4325167
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C tRNA-synt_1e GST_C_2 GST_C_3 GST_C_6 PPR_3
Other DBs
NCBI-GeneID: 4325167
NCBI-ProteinID: XP_015651457
UniProt: Q0JNQ8
LinkDB
Position
1:complement(9373753..9378224)
AA seq 715 aa
MEPKLAFPQDSPPLAILCAAKVAGVSLTLDPKLASGSAPTLHLGSGDFIHGVNTILRYIA
RVASVTSFYGQDAIQAAYVDQWLDYAPVILSGSEFEAACSFLDGYLASRTFLVSYGLSIA
DIVVWSNLAGTGQRWESLRRSKKYQNLVRWFNSIADYSDTLDEVVSAYVGKRGIGKSPAP
SLKEKLPDSKQNISIPEVDLPGAKVGEVCVRFAPEPSGYLHIGHAKAGLLNKYFAERYKG
RLIVRFDDTNPSKESNEFVENVLKDVETLGIKYDIVTYTSDYFPQLMEMAENLIKQGKAY
VDDTPKEQMRSERMDGVESKCRNNTVQDNLSLWKEMINGTERGMQCCVRGKLDMQDPNKS
LRDPVYYRCNTDPHHRIGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRIL
QEMGLRRVEIYEFSRLNMVYTVLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKVEA
LVQFILEQGASKNLNLMEWDKLWTINKKIIDPVCGRHTAVLKDQRVLFTLTNGPEEPFIR
VLPRHKKYEGAGKKATTFTNKIWLESADASVISIGEEVTLMDWGNAIIKEIKTQNGIITE
LLGELHLEGSVKMTKLKLTWLPDIEDLVSLSLVEFDYLIKKKKLEEDDNFLDNLNPCTCQ
EFPALGDANMRNLKQGEIIQLERKGYYRCDAPFIRSSKPIVLFAIPDGRQKSATK
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggagccgaaactagcattcccccaggatagtccaccacttgccatcctctgtgctgct
aaggtcgcaggtgtttccctcaccctcgatccgaagctcgcctcgggttcagcacccaca
cttcaccttggttctggggattttatccacggtgttaacacaattcttcgttacattgct
cgtgttgcatctgttaccagtttctatggtcaggatgctattcaggcagcatatgttgat
caatggctcgactacgccccagtcattctttcaggatctgaatttgaagctgcttgctca
tttctagatggatacctagcatcacgaacctttttggttagttatggcttgtcaattgct
gacattgtagtatggtcaaatcttgcagggacaggccaacgatgggaaagtctaaggagg
tccaagaaatatcaaaaccttgttcgctggttcaacagcatagcagactattcagacaca
ctagatgaagttgtctctgcttatgttggaaaaagggggataggaaagtctcctgcacca
agcctgaaagagaaattacctgattcaaagcagaatatctcaatccctgaagtagatctc
ccaggtgcaaaagttggggaggtctgcgttcgctttgcccccgagcctagtgggtatctt
cacattggtcatgcaaaggctggacttttgaacaagtactttgctgagagatataaaggg
cgcctgatagttcgatttgatgacacaaacccttcgaaagaaagcaatgaatttgttgag
aacgtcctgaaggatgtagaaacactgggaataaaatatgatatagttacttacacatca
gattattttccgcagttaatggaaatggctgaaaatttgattaagcaagggaaggcttat
gttgatgatacaccaaaggagcaaatgaggagtgagagaatggatggtgtggaatctaaa
tgtagaaataatactgttcaggataatttgtcattgtggaaagagatgatcaatggaact
gaaaggggtatgcagtgttgtgtacggggtaaacttgacatgcaggaccctaacaaatca
cttcgagatcctgtatactaccgttgcaacactgatccccatcatcgtattggctcaaaa
tacaaggtctatccaacttatgactttgcttgtccatttgtcgacgcattggaaggagtg
actcatgctctccgctcaagtgaataccatgatcggaatgcacagtactatcgtatcctt
caagaaatggggttaaggagggtagaaatctatgagttcagcaggttgaatatggtttac
acggttcttagcaaacgcaagcttctctggtttgtacaaaacaaaaaggtggaggactgg
actgatccacgcttccccactgtacaaggcatagtacgtcgtggcttgaaggttgaagct
ttggtacaatttatacttgagcagggtgcctctaaaaatctaaatcttatggagtgggat
aaactctggacaatcaacaagaagataattgatccagtgtgtggaaggcatactgccgtt
ctgaaagaccagcgtgtgcttttcactcttactaatggtccagaggaaccattcatccga
gtcttacccaggcacaagaaatacgaaggtgctggaaagaaggctacaaccttcacaaac
aaaatttggttggagagtgctgatgcatcagttattagcatcggtgaggaagttactctg
atggactggggaaatgctatcatcaaagaaatcaagacacagaatggaattataactgaa
ctgcttggggaactccatcttgaggggtcagttaagatgacaaagttaaagctaacgtgg
ctgccagatattgaagatcttgtatctctctcgttggtagagtttgactacctaatcaaa
aagaaaaagctggaagaagatgataatttccttgacaatcttaatccatgcacttgccaa
gagtttccggctcttggagacgcaaacatgcggaatctcaaacaaggagaaatcatacag
cttgaaaggaaagggtattacaggtgtgatgctccatttatccggtcttccaaaccaatt
gtccttttcgctattccagatggacgacaaaagtccgcaacgaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328118
Entry
4328118           CDS       T01015                                 
Name
(RefSeq) glutamate--tRNA ligase, chloroplastic/mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4328118
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4328118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4328118
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4328118
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:osa02048]
    4328118
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     4328118
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4328118
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4328118
 Prokaryotic type
   Other AARSs
    4328118
Prokaryotic defense system [BR:osa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    4328118
SSDB
Motif
Pfam: tRNA-synt_1c Anticodon_2
Other DBs
NCBI-GeneID: 4328118
NCBI-ProteinID: XP_015622843
UniProt: B9F261 Q6YUS0
LinkDB
Position
2:complement(1090398..1095997)
AA seq 567 aa
MMAAAMGSPWLRIRLLPEVPPRLLRPHLRRTLSVRASASASASPDGAGGPVRVRFAPSPT
GNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTKKSEEAVLSDLAWLGLDWDEGP
DVGGEFGPYRQSERNSMYKQYAEKLMESGAVYQCFCSSEELEQMKETAKQMQLPPVYMGK
WGTASDAEIQQELEKGTPYTYRFRVPKEGSLKINDLIRGEVSWNLDTLGDFVIMRSNGQP
VYNFCVTVDDATMRISHVIRAEEHLPNTLRQALIYKALGFPMPSFAHVSLILAPDRSKLS
KRHGATSVGQYKEMGYLPQAMVNYLALLGWGDGTENEFFTIDDLVEKFTINRVNKSGAVF
DAVKLKWMNGQHLRSFPPDVLIKSFEDRWKDTGILQESESGFAKEAAELLKDGIDLITDA
DAALSNLLSYPLHATLSSDEAKSVVQDKLSEVASGLISAYDSGELCQALAEGRDGWQKWV
KIFGKSLKRKGKSLFMPLRVLLTGKLHGPDMGGTVVLIHKAGTCGAVTQQSGFVNLDERF
RILKEVEWESLVQEQESPAETAVPASR
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgatggcggcggcaatggggtcgccatggctgcgcatcaggctgctcccggaggtgccg
ccgcgcctcctgcggccccacctccgccggaccctctccgtccgcgcctccgcctccgcc
tcggcgtcaccggacggcgccggcggcccggtgcgggtccgcttcgcgccgtcgccgacg
ggcaacctccacgtcggcggcgcccgcaccgcgctcttcaactacctcttcgcgcggtcc
aaggggggcaagttcgtgctccgcatcgaggacaccgacctcgagaggtccaccaagaag
tccgaggaggccgtgctcagtgacctcgcctggctcggccttgactgggacgaaggtccc
gatgttggtggggaatttgggccgtatcgccagtccgagcgcaattcgatgtacaaacag
tatgccgagaagctgatggagtctggtgcagtctatcagtgcttttgctccagtgaggaa
cttgaacagatgaaagaaactgcaaagcagatgcaacttccacctgtatacatgggcaag
tgggggactgcttcagatgcagaaatacaacaggagttagagaaggggacaccttacact
taccgtttccgtgtaccgaaggaagggtcgttgaaaattaatgaccttattcgtggtgag
gtcagttggaacttagacacgcttggtgatttcgtgattatgagaagcaatggccagcca
gtgtataacttctgtgtcacagttgatgatgctaccatgcgcatctctcatgttatcaga
gctgaagaacatctgccaaacacattacggcaggctcttatttataaagcacttggattt
ccaatgccttcgtttgctcatgtatcacttattctagctcctgatagaagtaaactgtct
aaacgtcatggggctacttctgtgggacagtacaaagagatgggctatttgcctcaggca
atggtaaattatttggcacttcttggttggggtgatggtactgaaaatgagttcttcacc
attgatgacctagtggaaaaattcactataaatcgtgtcaacaaaagtggagcagtcttt
gatgctgtaaaattaaaatggatgaatggacaacatctaagatcatttccccctgatgta
ctcatcaagagttttgaggatagatggaaggacacaggcattctccaggagtctgaaagt
ggttttgctaaagaagcggctgagcttttgaaggatggcatcgatttgatcactgatgct
gacgcagccctttcaaacctgttgtcgtatcccctccatgctacattaagcagtgatgaa
gctaaatctgtggtgcaagacaagctttctgaggttgcatcaggactcatttctgcttat
gatagcggtgaactttgtcaagcactagctgagggccgtgatggttggcagaagtgggtg
aaaatttttggcaaatcacttaaaagaaagggaaagtcactctttatgccgctccgtgta
ctgctgactggcaagcttcatgggcctgacatgggcggcaccgtagtcctcatacacaaa
gccggcacctgtggagcggtcactcagcaatccggtttcgtaaatctcgacgagaggttc
agaatcctgaaggaggtggagtgggagtcactggtacaggagcaagagtccccagctgaa
actgccgttcctgcttctcgatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348464
Entry
4348464           CDS       T01015                                 
Name
(RefSeq) glutamate--tRNA ligase, cytoplasmic
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4348464
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4348464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348464
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4348464
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:osa02048]
    4348464
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     4348464
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4348464
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4348464
 Prokaryotic type
   Other AARSs
    4348464
Prokaryotic defense system [BR:osa02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    4348464
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C tRNA-synt_1e GST_C_3 GST_C GST_C_6 GST_C_2
Other DBs
NCBI-GeneID: 4348464
NCBI-ProteinID: XP_015614227
UniProt: Q8S5M6 A3C430
LinkDB
Position
10:complement(11581403..11585302)
AA seq 713 aa
MEAKLSFSQDSPPISIISAAKVAGVSLSIDPSLAAGSAPVLCFSSGESLRGINPILEYIA
QSSPSLHGRDAIESGHVVEWLEYAPTFLLGSEFEVACSFVDGYLMSRTFLVGHVLTIADI
TVWSNLAGIGQRWESLRKSKKYQNLVRWFNGIDSDYKDTLNEVIAAYVGKRGIGKSPAPN
LKEKVNDSKDPSAPEVDLPGAKFGEVCVRFAPEPSGYLHIGHAKAALLNKYFAERYQGRL
IVRFDDTNPSKESNEFVENLLKDIETLGIKYDAVTYTSDYFPKLMEMAEKLIKQGKAYVD
DTPKEQMRSERMDGVESKCRNNTVEENLSLWKEMINGSERGMQCCVRGKLDMQDPNKSLR
DPVYYRCNTDPHHRIGSKYKVYPTYDFACPFVDALEGVTHALRSSEYHDRNAQYYRILQD
MGMRRVEIYEFSRLNMVYTLLSKRKLLWFVQNKKVEDWTDPRFPTVQGIVRRGLKVEALI
QFILQQGASKNLNLMEWDKLWTINKKIIDPVCARHTAVLKDQRVIFRLTNGPEKSFVQIL
PRHKKFDGAGKKATTFTNRIWLDYADASAISKGEEVTLMDWGNAIIKEIKMENGVITELI
GELHLEGSVKTTKLKVTWLPDIDDLVPLSLVEFDYLISKKKLEEDENFLDNLNPCTRKET
LALGDANMRNLLRGEVIQLERKGYYRCDAPFVRSSKPVVLFAIPDGRQQASLN
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggaggcgaagttatcgttttctcaggacagcccgccaatttccataatttctgctgct
aaggttgccggtgtctccctgtccatagatcctagtcttgctgcgggctcagcacccgtt
ctatgcttcagttctggagaatcactccgtggtatcaaccctattctcgagtacattgcc
caatcctctccaagcctccatggccgagatgctattgagtctggacatgttgttgaatgg
cttgaatacgcccccaccttccttttaggatcagaatttgaggttgcctgctcatttgtt
gatggatacttgatgtctcggacctttctggttggtcatgttttaacgattgctgatatc
actgtatggtcaaatctggctgggattggtcaacgatgggagagtctacggaaatcaaag
aaataccaaaatcttgtccgttggttcaatggcatagattcagactacaaagacacattg
aatgaggttatagctgcttatgttgggaaacgaggaattgggaaatcccctgcaccaaac
cttaaggaaaaggttaatgactcaaaggatccttcagctccagaagttgatctccctggt
gcaaaatttggagaggtgtgtgttcgctttgccccagagcccagtggttacctccatata
ggtcatgcaaaggctgcactcttgaacaagtactttgcagaaagatatcaaggtcgatta
attgttcgatttgatgacactaacccttcaaaagaaagcaatgagtttgttgaaaacctc
ctaaaagatattgagaccctgggaatcaaatatgatgctgtcacatacacatctgattat
tttccaaagctaatggaaatggctgaaaaactgattaagcagggaaaagcatatgttgat
gacacaccaaaggagcaaatgagaagtgagagaatggatggtgtggagtcaaagtgcaga
aataatactgtggaggaaaatctgtctctatggaaagagatgataaatggttctgaaagg
ggtatgcaatgctgtgtgaggggtaaacttgacatgcaggatcctaacaagtcccttcgg
gatccagtttactaccgttgcaacactgatcctcaccatcgtattggttcaaagtacaag
gtctatccaacttatgactttgcttgtccattcgttgatgcgctggagggagtgacccat
gctcttcgttccagtgaatatcatgacaggaatgcacaatactatcgaattcttcaagat
atggggatgaggagagtagaaatatatgagttcagcagattgaatatggtttatactctt
cttagcaagcggaagctgctttggtttgtgcagaacaagaaggttgaagattggacagac
cctcgtttccccactgttcaaggcatagtacgccgtggcttgaaagttgaggctttgata
caatttatactccaacagggtgcttcgaaaaatttgaatcttatggagtgggataaactc
tggacaatcaacaagaaaataattgacccagtttgtgcaaggcatactgctgtgttgaaa
gatcagcgtgtgatcttcaggcttactaatggtccagagaaatcatttgttcaaattttg
ccaaggcacaagaaatttgatggtgcaggaaagaaggcaacaaccttcacaaacagaatt
tggctagattatgctgatgcatctgcaattagcaagggtgaggaagttactctgatggac
tggggaaatgccatcattaaagaaatcaagatggagaatggagtaattactgaactgatt
ggagaactacatcttgagggatctgtgaagacaacaaaattgaaggttacatggcttccg
gacatagatgatctggttcctctctcattggtggaatttgattacctgattagcaagaag
aagcttgaggaggatgagaacttccttgacaacctgaacccatgcactcggaaagaaacc
ctggccctaggagacgcaaatatgaggaacctcctgcgtggggaggtcatacagcttgag
aggaaaggctattacaggtgcgatgccccttttgtcagatcctcgaagccggtggttttg
ttcgctatccctgatggtcgacagcaggccagtttgaactag

DBGET integrated database retrieval system