KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325169
Entry
4325169           CDS       T01015                                 
Name
(RefSeq) NEDD8-activating enzyme E1 catalytic subunit
  KO
K10686  NEDD8-activating enzyme E1 [EC:6.2.1.64]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4325169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325169
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.64  E1 NEDD8-activating enzyme
     4325169
Ubiquitin system [BR:osa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   4325169
SSDB
Motif
Pfam: ThiF E2_bind Shikimate_DH Pyr_redox
Other DBs
NCBI-GeneID: 4325169
NCBI-ProteinID: XP_015610620
UniProt: B9EV56 A0A0P0V127
LinkDB
Position
1:9386183..9390617
AA seq 451 aa
MSSPDEDPPTEPERWRDLDMLLSRPGNLVHADFNPSPGLRDSLGSLVEVLVVGAGGLGCE
LLKDLALSGFKNIHVIDMDTIDVSNLNRQFLFRVQDVGKSKAEVAAKRVMERVSGVNIVP
HFCRIEDKEIEFYSQFSIIVLGLDSIEARSYINSVACGFLEYDSDDKPIPETLKPMVDGG
TEGFKGHARVIIPGTTPCFECNIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWNEVH
PGKPFDADDAEHMQWIYSEALKRAELFGISGVTYSFTQGVVKNIIPAIASTNAIVSAACA
LEALKLISGCSKTVSNYLTYNGLDGTHINVSEFAREKDCLVCGPGTLIELGTSTTLSEFI
KMLEEHPKLLMSRASVTHEGDNLYMQAPEVLEQMTRPNLGVPMFELLKGAARTTVHVTGM
AENNGKKVSSLRKLRVTFKGVEESSKMDESS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtcctcccccgacgaggacccgccgacggagcccgagcggtggagggatctggacatg
ctcctctcccgccccggcaacctcgtccacgccgacttcaaccccagccccgggctgcgg
gactcgctggggagcctcgtggaggtgctggtggtgggcgcgggcgggctggggtgcgag
ctcctcaaggacctggcgctctccggattcaagaacatccacgtcatcgacatggacacc
atcgacgtctccaacctcaaccgccagttcctcttcagggttcaagatgttgggaagtcc
aaggctgaagttgctgcaaagagggttatggagcgagttagtggagtgaacattgttcca
catttctgtaggattgaagataaagagatagagttctacagtcaattctcgataattgtt
cttggtctagattcaattgaagctcgaagctatatcaattccgtggcgtgtggtttctta
gagtatgactcagatgacaagccaatccctgagacgcttaaacctatggtcgatggtggg
actgaaggtttcaaaggtcatgctagagtcatcatacctgggacaacaccttgttttgaa
tgcaacatatggcttttccctccccaggtcaaatttcccttatgtacacttgctgagact
ccgagaactgcagctcattgcattgaatatgctcatttgatcaaatggaatgaggttcat
cctgggaaaccttttgatgctgatgatgcagaacatatgcagtggatttactcagaggct
ttaaagagagcagaactttttggtatttctggagttacatattcgtttacccagggtgtt
gtcaagaatatcatcccagccattgcttcaacaaatgcaattgtttctgctgcatgtgcg
ttggaagctcttaagcttatctctgggtgcagcaaaactgtgtcgaattatctcacgtat
aacggccttgatggaacacacattaatgtaagcgaatttgcaagagagaaagactgcctt
gtatgtggacctggtacccttattgaacttgggacatcgactaccctctcagagttcatc
aagatgcttgaagagcaccccaagctgctaatgtcgagggctagcgtaacacacgaaggc
gataacctctacatgcaggcacctgaagtcctagagcagatgacgcgaccaaacctgggt
gtcccaatgtttgagctactcaaaggagctgcacgcacgactgtgcatgtaactggaatg
gcagaaaacaacgggaagaaagtatcctctctgaggaagctgcgtgttactttcaagggc
gtcgaggaatcttcgaaaatggatgagagttcttga

DBGET integrated database retrieval system