KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325173
Entry
4325173           CDS       T01015                                 
Name
(RefSeq) probable 26S proteasome complex subunit sem1-1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4325173
  09124 Replication and repair
   03440 Homologous recombination
    4325173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325173
   04131 Membrane trafficking [BR:osa04131]
    4325173
   03051 Proteasome [BR:osa03051]
    4325173
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325173
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     4325173
Membrane trafficking [BR:osa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4325173
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4325173
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     4325173
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 4325173
NCBI-ProteinID: XP_015627757
UniProt: Q0JNQ2 A2ZRP4
LinkDB
Position
1:complement(9441626..9444312)
AA seq 76 aa
MAAAAPADAKAEAAKMDLLEDDDEFEEFEIDQEWDDKEDGDEAIQQWEDDWDDDDVNDDF
SLQLRKELEECNTQKI
NT seq 231 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgccggcggacgcgaaggcggaggcggccaagatggacctcctcgag
gacgacgacgagttcgaggagtttgagatcgaccaagaatgggatgacaaggaggatggt
gatgaggccatccagcaatgggaggatgattgggatgatgacgacgtcaatgacgacttc
tcgcttcagctgaggaaggagctggaggaatgcaacacccagaagatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327264
Entry
4327264           CDS       T01015                                 
Name
(RefSeq) probable 26S proteasome complex subunit sem1-1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4327264
  09124 Replication and repair
   03440 Homologous recombination
    4327264
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327264
   04131 Membrane trafficking [BR:osa04131]
    4327264
   03051 Proteasome [BR:osa03051]
    4327264
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327264
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     4327264
Membrane trafficking [BR:osa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4327264
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4327264
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     4327264
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 4327264
NCBI-ProteinID: XP_015615618
UniProt: Q8RZS5
LinkDB
Position
1:11970665..11972440
AA seq 75 aa
MADTAKADAAAEAAKMDLLEDDDEFEEFEIDQEWDDKEEGNEAVQQWEDDWDDDDVNDDF
SLQLRKELESIPSKN
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcggatacggcgaaggccgatgcggcggcggaggcggccaagatggacctgctcgag
gacgacgacgagttcgaggagtttgagatcgaccaagaatgggatgacaaggaagaaggc
aacgaggcagttcagcaatgggaggatgactgggatgacgatgatgtcaatgacgacttc
tctctgcagctcaggaaagagctggagagcatcccatcgaagaactag

DBGET integrated database retrieval system