KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325174
Entry
4325174           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin-conjugating enzyme E2 C
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4325174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325174
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4325174
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4325174
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 4325174
NCBI-ProteinID: XP_015633764
UniProt: A2ZRP5 Q9LIY1
LinkDB
Position
1:9445674..9446592
AA seq 191 aa
MARGENNTGAHGSGNVPPPATAASTAAGTAAASGKQQARGAGAEGQSVVRRLQSELMALM
MGGDPGVSAFPEGDNIFSWVGTIAGSAATAYEGTSYRLSLAFPGEYPYKPPKVRFETPCF
HPNVDAHGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNNDSPLNTQAAALWPNQDEFR
KMVEKLYKPTA
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcgaggggcgagaacaacaccggcgcgcacggcagcggcaacgtgcctcctcccgcc
accgccgcgtccacggcggcggggacggcggccgcgtccgggaagcagcaggcgcggggg
gcgggggcggaggggcagtcggtggtgcggcggctgcagtcggagctgatggcgctgatg
atgggcggcgacccgggcgtgtccgcgttcccggagggggacaacatcttcagctgggtg
ggcaccatcgccgggtccgccgcgacggcgtacgagggcacctcctaccgcctctccctc
gccttccccggcgagtacccgtacaagccgcccaaggtgaggttcgaaaccccctgcttc
cacccaaacgtggacgcccacggcaacatctgcctcgacatcctccaggacaagtggtcc
tccgcctacgacgtccgcaccatcctcctctccatccagagcctcctcggcgagcccaac
aacgactcccccctcaacacccaggccgccgccctctggcctaaccaggacgagttcagg
aagatggtcgagaagctctacaagcccaccgcgtag

DBGET integrated database retrieval system