KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325222
Entry
4325222           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 734A6
  KO
K15639  PHYB activation tagged suppressor 1 [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4325222
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4325222
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4325222
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP734 family
   4325222
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4325222
NCBI-ProteinID: XP_015631278
UniProt: B9X287
LinkDB
Position
1:complement(16325462..16328718)
AA seq 542 aa
MGWWGWAAAAAAAAAWVAVKVLEVLWWRPRRVEEHFARQGITGPRYRFLVGCVREMVALM
VAASAKPMPPPYRSHNVLPRVLAFYHHWKKIYGSTFLIWFGPTPRLAIADPELIREVLLA
RADRFDRYESHPMVRQLEGEGLVSLRGDKWAHHRRVLTPAFHMDNLRLLLPCVGMTVLDM
ADKWRAMAEADKSGEVEIDVSDWFQVVTEDAITRTAFGRSYEDGKVVFKLQAQLMAFASE
AFRKVFIPGYRFLPTKKNTSSWKLDKEIRKNLVTLIGRRQEAGDDEKLDGCAKDLLGLMI
NAAASSNGGKRSALPVSPITVNDIVEECKTFFFAGKQTTSNLLTWAIVVLAMHPEWQERA
RQEVLDVCGADGVPSREQLAKLKTLGMILNETLRLYPPAVATVRRAKADVELGGYLRIPR
DTELLIPIMAVHHDARLWGPDAAQFNPARFAGGVARAARHPAAFIPFGLGARMCIGQNLA
ILEAKLTVAVILHRFEFRLSARYVHAPTVLMLLHPQYGAPIVFRPRSSSQPTCEKMNPLT
SS
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggggtggtgggggtgggcggcggcggcggccgcggcggcggcgtgggtagctgtgaag
gtattggaggtgctgtggtggcggccgcggcgggtggaggagcacttcgcgcggcagggg
atcacggggccgagataccggttcctggtgggttgcgtgcgcgagatggtggcgctcatg
gtggccgcctccgccaagccaatgccgcccccctaccgctcccacaacgtcctcccccgt
gtgctcgccttctaccaccactggaagaaaatctacggttccacgttcctgatatggttc
ggcccgacgccgcggctggccatcgccgacccggagctgatccgggaggtgctcctggcg
cgcgccgaccgcttcgaccgctacgagtcgcaccccatggtacggcagctggagggcgag
ggcctcgtcagcctccgcggcgacaagtgggcccaccaccgcagggtgctcacgccggcc
ttccacatggacaacctccgcctcctcctcccctgcgtcgggatgacggtcctcgacatg
gccgacaagtggcgcgccatggccgaggccgacaagtccggcgaggtcgagatcgacgtg
tccgactggttccaggttgtcacggaggacgccatcacgcgaacggcgttcggccggagc
tacgaggacggcaaggtcgtcttcaagctccaggcgcagctcatggccttcgcctccgag
gctttccgcaaggtcttcatccccggatacagattcttgccgaccaagaagaacacgagc
tcgtggaagctggacaaggagatcaggaagaacctggtgacgctgattggtcggcggcaa
gaggcgggtgacgacgagaagctcgacggctgcgccaaggacctcctcggtctaatgatc
aacgccgccgccagcagcaacggcgggaagagatcggcgctaccggtgagccccatcaca
gtaaacgacatcgtcgaggagtgcaagacattcttcttcgccggcaaacagacgacgtcg
aacctcctgacatgggccatcgtcgtactcgccatgcacccggagtggcaggagcgcgct
cgccaagaggtcctcgacgtctgcggcgctgacggcgtcccctctcgcgagcagcttgcc
aagctcaaaacgctcgggatgatcctgaacgagacgctgcggctgtacccgccggcggtg
gcgacggtgcggcgcgccaaggcggacgtggagctcggcggttacctgcggatcccacgc
gacacggagctgctgatcccaatcatggccgtgcaccacgacgcgcggctgtgggggccc
gacgcggcgcagttcaacccggcgcggttcgccggaggcgtggcccgggcggcgaggcac
ccggcggcgttcataccgttcggccttggggcacggatgtgcatcgggcagaacctcgcc
atcctggaggcgaagctgaccgtcgccgtcatcctgcatcggttcgagttccggttgtcg
gccagatacgtccacgcgccgacggtgctgatgctcctccacccgcagtacggggcgccc
atcgtcttccggccccgctcatcatcccaaccaacctgtgaaaagatgaacccgctaacc
agcagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341450
Entry
4341450           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 734A4
  KO
K15639  PHYB activation tagged suppressor 1 [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4341450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4341450
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4341450
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP734 family
   4341450
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4341450
NCBI-ProteinID: XP_015641577
UniProt: Q69XM6
LinkDB
Position
6:23704688..23707311
AA seq 538 aa
MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGPPYRFLVGCVREMVALM
AEATAKPMPPAAPHNALPRVLAFYHYWRKIYGPTFLIWFGPTPRLTVAEPEMVREIFLTR
AEAFDRYEAHPVVRQLEGDGLVSLHGDKWAHHRRVLTPGFYPDNLNRLVPHVGRSVAALA
ERWRAMACAGGGEVEVDVAEWFQAVAEEAITRATFGRSYDSGRVVFRLQARLMAFASEAF
RKVLVPGYRFLPTKKNRMSWGLDREIRRGLVRLIGRRSGGDGGEEDETTTELKDKQDSGF
NDLLGLMINAGVDRTMPVEDMVEECKTFFFAGKQTTTNLLTWATVLLAMHPDWQDRARRE
VLAVCGDAAGELPTKDHLPKLKTLGMILNETLRLYPPAVATIRRAKFDVTLGGGGDGDAG
GIHIPRDTELLVPIMAIHHDARLWGPDAAQFNPARFASGAARAAKHPLAFIPFGLGSRMC
IGQSLAILEAKLTMAVLLQRFDLALSPTYVHAPTVLMLLHPQYGAPLIFRPRQSQPSN
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgatggaggcggtggccgtggcggcggcggtgctgctgctgctgcacgtggcggcgagg
gtggcggacgcggtgtggtggcggccgaggcggctggaggcgcacttcgcggggcagggg
gtgcgcggcccgccgtaccggttcctcgtcgggtgcgtgagggagatggtggcgctcatg
gcggaggccaccgcgaagcccatgccgcccgccgcgccgcacaacgcgctccccagggtg
ctcgcgttctaccactactggaggaagatctacgggccgacgttcttgatttggttcggg
ccgacaccgcggctcacggtggcggagccggagatggtgcgggagatcttcctcacgcgc
gccgaggcgttcgaccgctacgaggcgcaccccgtggtccggcagctggagggcgacggg
ctcgtcagcctccacggcgacaagtgggctcaccaccgccgcgtcctcacccccggcttc
taccccgacaacctcaaccggctggtgccgcacgtcggcaggtcggtggcggcgctggcg
gagaggtggcgcgccatggcgtgcgccggcggcggcgaggtggaggtggacgtggcggag
tggttccaggcggtggcggaggaggccatcacgcgcgccacgttcggccgcagctacgac
tccggccgcgtcgtgttccgcttgcaggcccgcctcatggcgttcgcctccgaggccttc
cgcaaggtgctcgtcccgggatacaggttcctgccgaccaagaagaacaggatgtcgtgg
ggcctggacagggagatcaggcgcggcctggtccggctcatcggccggcgcagtggcggc
gacggcggcgaggaagacgagaccaccaccgagctcaaagacaagcaggacagcggcttc
aacgacttgctggggctcatgatcaatgccggcgtggacaggacgatgccggtggaggac
atggtggaggagtgcaagaccttcttcttcgccggcaagcagacgaccaccaacctgctc
acctgggccaccgtgctgctcgccatgcacccggactggcaggaccgcgcccgccgcgag
gtcctcgccgtctgcggcgatgccgccggcgagctccccaccaaggaccacctccccaag
ctcaagacgctcgggatgatcctcaacgagacgctgcgcctgtacccgccggcggtggcc
accatccgccgcgccaagttcgacgtcaccctcggcggcggtggcgacggcgacgccgga
ggcatccatatcccgcgcgacacggagctgctcgtcccgatcatggcgatccaccacgac
gcccggttgtgggggcccgacgcggcccagttcaacccggcgaggttcgccagcggcgcg
gcgcgcgcggcgaagcacccgctcgccttcatcccgttcgggctgggctcccgcatgtgc
atcggccagagcctcgccatcctcgaggccaagctcaccatggccgtcctcctccagcgc
ttcgacctcgcgctctcgcccacctacgtgcacgcccccaccgtgctgatgctgctccac
ccgcagtacggcgcgccgttgatcttccggccgcgccaatctcagccgtccaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344107
Entry
4344107           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 734A5
  KO
K15639  PHYB activation tagged suppressor 1 [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4344107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4344107
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4344107
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP734 family
   4344107
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4344107
NCBI-ProteinID: XP_015648047
UniProt: Q8LIF2
LinkDB
Position
7:complement(27019087..27023702)
AA seq 537 aa
MWSSWAWTWSWSGAAAVAVAAAAAWVAVYAAAARAAEALWWRPRRVERHFAAQGVRGPGY
RFFVGSSIELVRLMVDAASRPMEPPTSHDILPRVLPFYHHWRKLYGPMHLIWFGRTPRLV
VSEPELIREVLLTRADHFDRYEAHPMICQFEGYGLSNLHGERWARRRRVLTPAFHTENLR
MIAPFVAGTVTRMLDELAERARAGGAGEAEVDVAEWFQRVPQEAITFAAFGRRNYDDGAA
VFRLQDELAGYATEAHSKVYIPGYRFLPTRKNRRVWQLDREIRSHLAKFVTGLQSCSSSH
GDDADDGGDGGGGMREFMSFMAPAMTAGEIIEESKNFFFAGKETLSNLLTWTTVALAMHP
EWQERARREVVAVCGRGDLPTKDHLPKLKTLGMILNETLRLYPPAVAMIRTAKEDVELGG
CVVPAGTEVMIPIMAVHHDAAAWGDDAAEFNPARFAADDDGGRRRHPMAFMPFGGGARVC
IGQNMALMEAKVALAVVLRRFEFRLSPAYVHAPRVLMILSPQFGAPVIFRPLTSAAA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgtggtcgtcgtgggcgtggacgtggagctggagcggcgcggcggccgtggccgtggcg
gcggcggcggcgtgggtggcggtgtacgcggcggcggcgagggcggcggaggcgctgtgg
tggcggccgcggcgggtggagcggcacttcgcggcgcagggggtgcgggggccggggtac
cggttcttcgtggggagctcgatcgagctcgtccgcctcatggtggacgccgcctcccgc
cccatggagccacccacctcccacgacatcctcccccgcgtcctccccttctaccaccat
tggaggaagctctacggtccgatgcatttgatttggtttgggcggacgccgaggttggtg
gtgagcgagccggagctgatccgggaggtgctcctgacgcgggcggatcacttcgaccgg
tacgaggcgcacccgatgatctgccagttcgagggctacggcctcagcaacctccacggc
gagcggtgggcgcgccgccgccgggtgctcacgccggcgttccacaccgagaacctcagg
atgatcgcgccgttcgtcgccggcaccgtcacccgcatgctcgacgagctggcggagcgc
gcgcgcgccggcggcgccggcgaggcggaggtcgacgtcgccgagtggttccagcgcgtg
ccgcaggaggccatcacgttcgccgcgttcggccgccggaactacgacgacggcgccgcc
gtgttccggctccaggacgagctcgccggctacgccaccgaggcgcacagcaaggtgtac
atccccgggtacaggttcctccccacgaggaagaaccgccgcgtgtggcagctcgacagg
gagatcaggagccacctcgccaagttcgtcaccggcctgcagagctgcagcagcagccat
ggcgacgacgccgatgatggcggcgatggcggcggcggcatgagggagttcatgagcttc
atggcgccggcgatgacggcgggcgagatcatcgaggagagcaagaacttcttcttcgcc
gggaaggagacgctgtccaacctcctcacctggaccaccgtcgcgctcgccatgcacccg
gagtggcaggaacgtgcccgccgcgaggtcgtcgccgtctgcggccgtggcgacctcccc
accaaggaccacctccccaagctcaaaaccctcgggatgatcttgaacgagacgctgagg
ctgtacccgccggcggtggcgatgatacggacggcgaaggaggacgtggagctgggcggg
tgcgtggtgccggcggggacggaggtgatgatcccgatcatggccgtccaccacgacgcg
gcggcgtggggcgacgacgccgcggagttcaacccggcgaggttcgccgccgacgacgac
ggcggccggcgccgccacccgatggcgttcatgccgttcggcggcggcgcgcgggtgtgc
atcggccagaacatggcgctcatggaggccaaggtggcgctcgccgtcgtcctgcggcgc
ttcgagttccggctatcgccggcgtacgtgcacgcgcccagggtgctcatgatactcagc
ccgcagttcggcgcgccggtgatcttccggccgctgacgtcagccgcagcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268939
Entry
9268939           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 734A2
  KO
K15639  PHYB activation tagged suppressor 1 [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    9268939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9268939
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     9268939
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP734 family
   9268939
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9268939
NCBI-ProteinID: XP_015623670
UniProt: Q6Z6D6
LinkDB
Position
2:complement(5862892..5865812)
AA seq 557 aa
MEEDGGGGAGWGWATWRVAAVAAAAAVWVTMHVAARMADALWWRPRRLEAHFAAQGVRGP
PYRFLLGSVREMVALMAEASSKPMSPPTSHNALPRVLAFYHYWRKIYGHRFLIWFGPTPR
LTVAEPELIREIFLTRADAFDRYEAHPVVRQLEGDGLVSLHGDKWALHRRVLTDAFYPDN
LNRLIPHVGKSVAALAAKWGAMAEAGGSGEVEVDVAEWFQAVTEEAITRATFGRSYDDGR
VVFAMQGQLMAFASEAFRKVLVPGYRFLPTKKNRLSWRLDREIRRSLMRLIGRRSDEAEQ
GEKADDGSFRDLLGLMINAGAAAATRGNAGGEKNSPAAAIPVEDMLEECKTFFFAGKQTT
TNLLTWATVLLAMHPDWQERARREVFDVCGAGELPSKEHLPKLKTLGMIMNETLRLYPPA
VATIRRAKVDVQLSDGCMIPRDMELLVPIMAIHHDTRYWGPDASQFNPARFANGASKAAK
HPLAFIPFGLGSRMCVGQNLARLEAKLTMAILLQRFEIRTSPNYVHAPTVLMLLYPQYGA
PLIFRPLSSHPPDSTGP
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggaggaggatggcggcggtggcgcggggtgggggtgggcgacgtggagggtggcggcg
gtggcggcggcggcggcggtgtgggtgacgatgcacgtggcggcgaggatggcggacgcg
ctgtggtggcggccgcggcggctggaggcgcacttcgcggcgcagggggtgcgggggccg
ccgtaccggttcttgctcggctccgtgagggagatggtggcgctcatggcggaggcgtcg
tccaagcccatgtcgccgcccacctcccacaacgcgctcccccgcgtcctcgccttctac
cactactggcgcaagatctacgggcataggttcttgatttggttcgggccgacgccgagg
ttgacggtggcggagccggagctgatccgggagatcttcctgacgcgcgccgacgcgttc
gaccgctacgaggcgcaccccgtcgtgcgccagctcgagggcgacgggctcgtcagcctc
cacggcgacaagtgggcgctccaccgccgcgtcctcaccgacgccttctacccggacaac
ctcaaccggttgataccgcacgtcggcaagtcggtggcggcgctggcggcgaagtggggc
gcgatggcggaggccggggggagcggcgaggtggaggtggacgtggcggagtggttccag
gcggtgacggaggaggccatcacgcgcgccacgttcggccgcagctacgacgacggccgc
gtcgtgttcgccatgcagggacagctcatggcgttcgcctccgaggccttccgcaaggtg
ctcgtcccgggctaccggttcttgccgaccaagaagaaccggctgtcatggcggctggac
agggagatacggcggagcctgatgcggctcattggccggcggagcgacgaggccgagcaa
ggcgagaaggccgacgacggcagcttccgcgacctgctcggcctgatgatcaatgccggc
gccgccgccgccacccgcggcaacgccggcggcgagaagaactccccggcggcggcgatc
cccgtggaggacatgctggaggaatgcaagaccttcttcttcgccgggaagcagacgacg
accaacctcctgacgtgggccactgtgctcctcgccatgcacccggattggcaggagcga
gctcgccgcgaggtgttcgacgtctgcggcgccggcgagctcccctccaaggagcacctc
cccaagctcaaaacgcttggcatgatcatgaacgagacgctccggctgtacccgccggcg
gtcgccaccatccgccgagccaaggtcgacgtccagctctcggacgggtgcatgatcccg
cgggacatggagctgctcgtcccgatcatggccatccaccacgacacgagatactggggt
ccggacgcgtctcagttcaacccggcaaggttcgccaacggcgcgtccaaggcggcgaag
cacccgctggcgttcataccgttcgggctaggctctcggatgtgcgtaggccagaacctg
gcgcgcctcgaggccaagctcacgatggccatcctcctccagcggttcgagatcaggaca
tccccgaactacgtacatgccccgacagtgctgatgctcctatacccgcaatacggagcg
ccattgatcttccgcccgctctcatcacatccacccgattcgacgggcccctag

DBGET integrated database retrieval system