KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325237
Entry
4325237           CDS       T01015                                 
Name
(RefSeq) phosphatidylserine decarboxylase proenzyme 2
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325237
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     4325237
SSDB
Motif
Pfam: PS_Dcarbxylase EF-hand_5 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 C2
Other DBs
NCBI-GeneID: 4325237
NCBI-ProteinID: XP_015622516
LinkDB
Position
1:complement(42303453..42311233)
AA seq 659 aa
MGHSPSRHNACGGGGGDGESPPSPLPSRFERFRRRLRLRHRDRAGRPGGDAHASESGTGR
AIAVDEFAGIARIRIVKADMQFKDKFIACLSLGERTYRTEKSDNTSTPVWNSEKKVVVET
NGPHIARISVFETNRFSKNTLVGYCEVDLFELLTKDLDEHSEVLSLLDPSSSATIVGSIS
ISCYIEDPVETEQSFARRVLAIVDYNEDGELSLSEFSDLMKAFGNKLAVAKIEELFRQAD
KNGDGIVDMDELAALLANQQEKEPLISNCPVCGEILGKHDKINDMIHMTLCFDEGTGNQI
MTGGFLTDKQASYGWMFKLSEWAHFSSYDVGLHSGSTASHILVFDRRTKRLVEEVIDGKI
VLSMRALYQSKVGLTLIDTGVKDLLKNLSEKQGKKMSSPESAKDIPKFLELFKDQINLDE
VKDPLESFKTFNEFFVRQLKPGARPIACYEQDTIATCAADSRLMTFSSVDESTRLWIKGR
KFSIEGLLGKDVHSDALCNGSLVIFRLAPQDYHRFHVPVSGTLEKFVEIPGCLYTVNPIA
VNSKYCNVFTENKRVVSIISTSEFGKVAFVAIGATMVGSIEFLKEEGDYVHKGDEFGYFA
FGGSTVICVFEKDAIEFDADLLANSARSLETLVSVGMRLGVSTRNRDLQPQELEKCSLE
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgggccattcgccctcgcgccacaatgcatgcggcggcggcggcggcgacggcgagtcg
ccgccctcgccgctgccgtctcgcttcgagcggttccgccgccgcctccgcctgcgccac
cgcgaccgcgcggggcgtcccggtggcgacgcccacgcctccgagtcggggacggggagg
gccatcgccgtcgacgagttcgccggcatcgcgcgcatccggatagtgaaggcggatatg
cagttcaaggacaagttcatcgcgtgcctctcgctgggcgagcgcacgtaccgcaccgag
aagtctgacaatacttccacgcccgtatggaactctgaaaagaaggttgtggtagaaaca
aatggacctcacattgcacgcatatctgtctttgagactaaccgattctccaagaatact
ttggttggttactgtgaagttgatctgtttgaattgctcactaaggatctggatgaacac
tctgaggtcctttctctattggacccatcatcatcagctactattgtgggcagcatatcc
atctcatgttacattgaagatcccgttgaaacagaacaaagttttgcacgccgtgtcttg
gctatagtggattacaatgaagatggagagctatcattatctgaattctcagacctgatg
aaagcttttggtaataaattagcagttgcaaagattgaagagcttttccgtcaagctgat
aaaaatggtgatggtatagttgacatggatgaactggcagcccttctagctaatcaacaa
gagaaagaaccacttatcagtaactgtcctgtctgtggtgaaattcttggtaaacacgac
aaaataaatgatatgatacacatgacactttgttttgatgagggaactggtaatcagatt
atgactggaggatttctaacagataagcaagcatcatatgggtggatgtttaagcttagc
gaatgggctcatttttcctcgtatgatgttggtttgcactcgggctctactgcttctcat
atcttggttttcgaccggcgaactaagagactagttgaagaagttatagacggaaagatt
gtgttgtctatgagagctttataccaatcaaaagtagggctaactcttattgacacaggt
gtcaaagatctcttgaagaacctatctgagaagcaaggaaaaaagatgagctcacctgaa
tctgccaaagatattccaaagttccttgagttgtttaaggatcaaattaatttggatgaa
gtcaaggatcctcttgaaagtttcaagacatttaatgaattcttcgtaagacaactgaag
cctggggccagaccaattgcatgctatgagcaagacacaattgctacctgtgctgctgat
agtcgtttaatgactttcagttctgttgatgaaagcacaagattatggattaagggtcgc
aaattttctatcgagggtctccttgggaaggatgtacactctgatgctttgtgcaacgga
tcattggtaatctttcggcttgcgcctcaggattaccataggtttcatgttcccgtctca
ggaactttggagaaatttgtggaaattcctggatgcttgtacacggtcaatcctattgct
gtgaacagcaaatattgtaatgttttcaccgagaacaaacgagttgtttcaataatctca
acttcagagtttggaaaggtggcattcgtggccattggagcaacaatggttggaagcatc
gagttcttgaaagaagagggtgactacgtccacaaaggagatgagtttggatatttcgct
tttggagggagcacagtaatatgcgtctttgagaaggatgcaatagaatttgacgctgat
cttctggccaatagtgccagatcactggaaactctcgtctccgtcggcatgagactgggc
gtctccacaaggaacagagatctgcaacctcaagagctagagaaatgttcgcttgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331292
Entry
4331292           CDS       T01015                                 
Name
(RefSeq) phosphatidylserine decarboxylase proenzyme 1, mitochondrial isoform X2
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4331292
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     4331292
SSDB
Motif
Pfam: PS_Dcarbxylase
Other DBs
NCBI-GeneID: 4331292
NCBI-ProteinID: XP_015631994
UniProt: Q10T43
LinkDB
Position
3:139437..143414
AA seq 438 aa
MRRFRVWPPSPSPWPLLASRPCPHSHHHRSPFHASANSGARQGNFILPGATAATLVMFGI
LHARRMYEDQKVVERKEKGIEPEFSPDFKASFLRLLPLRSMSRLWGSLMEVELPVFMRPA
IYKAWARAFHSNLQEAAMPLEEYPSLQAFFIRSLKEGSRPIDADPNCLVSPVDGKVLRLG
ELRGPGTMIEQVKGFSYSAASLLGASSSLHGAEEEDFSREHTEQSNPADSNAKSWWRVSV
AKPKLWDQTLLSPKKGIFYCVIYLHPGDYHRVHSPVDWNIIKRRHFSGHLFPQNERAVRT
IRNLYVENERVVLEGQWKEGFVAIAAIGATNVGSIKLYIEPELRTNRAGSKILNSQPEPP
DDRVYEPVGTGVMVKKGEEIAGFKMGSTVVMVFEAPVVSKARWREDGSGTVTSDFDFCIK
AGDRIRVGEAIGRWTSRE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaggaggtttagggtttggcctccatctccatcgccatggccgctgctcgcttcccgc
ccttgccctcactcccaccaccatcgcagtcccttccacgcctccgccaactccggcgcc
cgccaaggcaattttattctacctggtgcaacggcagcaactcttgtcatgtttggtatt
ctacatgctaggcgtatgtacgaagaccaaaaagttgttgaaaggaaggagaaaggaatt
gagccggaattctcaccagatttcaaggcttcatttctcaggcttctgccattgcgttcg
atgtcacgtttatggggatccttgatggaagtggaacttccagtgttcatgcgccctgcc
atctataaagcatgggctagagccttccactccaatttgcaagaagctgctatgccacta
gaagaatacccttctttacaggcattcttcatccgtagtctcaaagaaggttcaaggccc
attgatgcagacccaaactgtctggtgagtcctgtggatggtaaagttctgcggcttgga
gaacttagaggtccaggaaccatgattgagcaagtgaagggcttttcttattctgctgct
tctcttctcggtgcaagttcatctcttcatggtgctgaagaagaagatttttctagagag
catacagaacaaagtaatcccgcagattcaaatgcaaaatcatggtggcgagtatcagtg
gctaaacccaaattatgggatcaaactctgctgagcccaaagaaaggcatcttctattgt
gtcatttatttacaccctggtgattatcatcgagttcactctcctgttgattggaacatt
ataaagcgccgacatttctcaggtcatctcttcccccaaaatgaacgtgccgtgcggacc
atcagaaacttgtatgttgagaatgaaagggtagtacttgaagggcagtggaaggaaggc
tttgttgcaattgcagccattggtgctactaatgttggctctatcaaactatatattgaa
ccagagctaaggacaaatagggcagggtcgaagatactgaactcccagcctgagcctcct
gatgatcgagtttatgaacctgtaggcaccggtgtgatggttaaaaagggggaagagata
gcagggtttaagatgggatcgacggtggtgatggtatttgaggcacctgtagtgtccaag
gcaagatggagagaggatggcagtggcacggtaacgtcagatttcgatttctgtatcaag
gctggcgataggatcagggtaggagaagccattgggcgatggacatcgcgggaatga

DBGET integrated database retrieval system