KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325306
Entry
4325306           CDS       T01015                                 
Name
(RefSeq) bifunctional riboflavin kinase/FMN phosphatase isoform X1
  KO
K20884  riboflavin kinase / FMN hydrolase [EC:2.7.1.26 3.1.3.102]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4325306
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     4325306
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     4325306
SSDB
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Flavokinase
Other DBs
NCBI-GeneID: 4325306
NCBI-ProteinID: XP_015649385
LinkDB
Position
1:complement(31836048..31839831)
AA seq 365 aa
MAATTPRVSAVIFDLDGTLLDTERATRDVLNEFLAAYGKVPDKEKEERRLGQMYRESTTG
IIADYGLPLTVEEYAVAIYPLYLKRWQKAKPLPGVERLVKHLHRNGVPLALASNSVRRNI
DHKLLKLKDWKDCFSVILGGDQVPRGKPSPDIFLEAAKGLGVNPSSCLVIEDSLVGVQGA
RASGAKVVAVPSLQSQRQHYSIADSILYSLLDFHPELWGLPPFEDRIQGALPIEQLFLNA
QIGHAISKSLHMVIAGDCTYEYVPDQISGIFFGWAKPEAGGVSRSVISIGWDFSLRTVER
VMHIYFLDSCCKITTEEPLKLQLVGYIRKLQSTENISQALAITDEDQAIARDALDLPVFS
EHAKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcggcaacgacgcccagggtctcggccgtgatcttcgacctcgacggcacgctcctc
gacacagagagggcaacgagggacgtcctgaacgagttcctggcggcgtacgggaaggtc
ccggacaaggagaaggaggagaggaggttggggcagatgtacagggagtccaccaccggg
atcatcgccgattatgggctaccgctcaccgtagaagagtacgctgtggcgatatacccg
ttgtacctgaaaaggtggcaaaaggcaaagccactccctggagtcgagaggcttgtcaag
catcttcataggaacggagtgcctctagcacttgcttcaaattccgtcaggagaaacatc
gatcacaaactgttaaaattaaaagattggaaagactgtttttctgtgattcttggtgga
gaccaggtccctcgtggaaaaccttcccctgacatatttctggaggccgcaaaaggactt
ggtgtaaatccatcatcatgtttggtcatagaagattctctcgtcggagttcagggtgcc
agggcttctggggcaaaagtagttgctgtcccatcactccaaagtcaaaggcagcactac
tcaattgctgattctatcctctactcactgctggactttcatcctgagttgtggggtctt
cctccttttgaagatcgcattcagggtgctttaccaatcgaacaattattcttgaatgcc
cagataggccatgcaatttcaaagagtcttcatatggtaatagcaggtgattgtacctat
gaatatgttcctgaccaaatatcaggaattttctttggttgggccaagccagaagcaggc
ggagtatctaggtcggtgataagcattggatgggacttttcgctgcggacagttgaaaga
gtgatgcacatatatttccttgattcctgttgtaagataacaacggaggagcccctgaag
ctgcagttagttgggtacatccggaagctccaaagcacggaaaatatatcacaagcattg
gccataactgacgaagatcaagccattgcaagggatgcattggacctcccagttttctct
gaacacgcgaagttataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348281
Entry
4348281           CDS       T01015                                 
Name
(RefSeq) bifunctional riboflavin kinase/FMN phosphatase
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4348281
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     4348281
SSDB
Motif
Pfam: Flavokinase
Other DBs
NCBI-GeneID: 4348281
NCBI-ProteinID: XP_015613307
LinkDB
Position
10:complement(7760801..7762223)
AA seq 104 aa
MVMSIGWNPYFDNTEKTIEPWLLHDFGEDFYGEELRLVIVGYIRPEANFPSLESLIERIH
EDARIAEKALNLPLYAKYTDSPYLRNSLKEDNSANGNQSVIDSK
NT seq 315 nt   +upstreamnt  +downstreamnt
atggtcatgagcattgggtggaacccttattttgataacacggagaagactattgaacca
tggttgcttcacgattttggtgaagacttttatggagaggagctgcgccttgttattgtt
ggttacatacgacccgaggccaactttccttcactagagagcttgatagagaggattcac
gaggatgcaaggatagcagagaaggccctgaatttaccattatacgccaagtatacagac
tcgccgtatctaagaaattccttgaaggaggacaattctgctaacgggaaccagtcagtg
atagattccaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348834
Entry
4348834           CDS       T01015                                 
Name
(RefSeq) bifunctional riboflavin kinase/FMN phosphatase isoform X1
  KO
K20884  riboflavin kinase / FMN hydrolase [EC:2.7.1.26 3.1.3.102]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4348834
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     4348834
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     4348834
SSDB
Motif
Pfam: Flavokinase HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Other DBs
NCBI-GeneID: 4348834
NCBI-ProteinID: XP_015614857
UniProt: A3C5J0 Q8H921
LinkDB
Position
10:complement(17133157..17137862)
AA seq 397 aa
MAAPKPIARLISHVILDLDGTLLNTDCVVSQVLKPFLVKNGKKWDSKKAHKLVGKTPYEA
AAVVLEDYGLPYSTEEFLSMLTPMFNEQWCNIKALPGANRLIKHLKSNGVPAALASNSPR
SNIDAKISCHQGWKESFSAIVGGDEVEKGKPSPDIFLEAAKRMNTNPPNCLVIEDSLPGV
AAGKAAGMHVIAVPSVPKRTAEFSSADEVINSLLDVKPEKWGLPPFSDWIDDTLPIEPWF
IGGPVIKGFGRGSKVLGIPTANLPAENFSDVLSEHTSGVYFGWAGLSTRGIFKMVMSIGW
NPYFDNTEKTIEPWLLHDFGEDFYGEELRLVIVGYIRPEANFPSLESLIERIHEDARISD
KALNLPLYAKYKDSPYLRNSLKEDNSANGNQSVIDSK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagctcccaagcccattgctcggcttatttcccatgtcattcttgatttagatggt
accctcttaaacacagactgtgttgtaagtcaagtgctgaaaccatttctagtcaaaaat
gggaaaaagtgggacagcaagaaagctcataaattagttggaaagacaccttatgaggca
gcagctgttgttttagaagattatggactcccttactcaacagaagaatttctctcaatg
cttactccaatgttcaatgagcaatggtgcaacataaaagctcttcctggagctaatcgg
ttgataaaacatttgaagagtaatggagtaccagctgctttggcttccaactcaccaaga
tcaaacattgacgcaaaaatttcctgccatcaaggatggaaagagtcgttctccgcaatt
gttggtggtgatgaagtagagaaggggaagccatccccagatatatttttggaagctgca
aaacgaatgaatacaaatcctccaaattgcttagtaatcgaggactccttaccaggtgtt
gcagctggaaaagctgcaggaatgcatgtcatagctgtaccttcagtccccaaaaggact
gctgaattcagttctgctgatgaggtgatcaattccctccttgacgtaaagcctgaaaaa
tggggattgccaccatttagtgattggatcgatgataccttaccaatagaaccatggttt
attggtggacctgtgattaaaggatttggccgtggttctaaagtactaggaattccaaca
gccaacttacctgcagaaaacttctccgacgtactatcagagcatacatcaggggtatac
tttggctgggctggactttcaacgcgaggtatatttaagatggtcatgagcattggctgg
aacccttattttgataacacggagaagactattgaaccatggttgcttcacgattttggt
gaagacttttacggagaggagctgcgccttgttattgttggttacatacgacccgaggcc
aactttccttcacttgagagcttgatagagaggattcacgaggatgcaaggatatcagat
aaggccctgaatttaccattatacgccaagtataaagactcgccgtacctaagaaattcc
ttgaaggaggacaattctgctaacgggaaccagtcagtgatagattccaagtga

DBGET integrated database retrieval system