KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325310
Entry
4325310           CDS       T01015                                 
Name
(RefSeq) phosphatidate cytidylyltransferase 1
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325310
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4325310
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     4325310
SSDB
Motif
Pfam: CTP_transf_1
Other DBs
NCBI-GeneID: 4325310
NCBI-ProteinID: XP_015622047
UniProt: B9EZR4 Q5JLS4
LinkDB
Position
1:complement(31870932..31877616)
AA seq 425 aa
MERDTSSSDVSASHVGRARQRRRPTEATADGNRTNGPALLVNDQNKYKSMLIRTYSTVWM
IGGFVLIVYMGHLYIWAMVVVIQIFMAKELFNLLRKSSEEKQLPGFRLLNWHFFFTAMLF
TYGRFLSRQLVNTVTSDHLLYKVVSGLIKYQMFICYFLYIAGFVWFILTLKKKTYKYQFK
QYAWTHMILLTVFAQSSFTVANIFEGMFWFLLPASLIVINDIAAYLFGFFLGRTPLIKLS
PKKTWEGFIGASVTTIISAFVLANVMGRFQWLTCPRKDLSTGWLRCDPGPMFKPEHYSLG
EWVPKGFPWKEVVLLPVQWHALALGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGG
ITDRMDCQMVMAVFAYIYHQSFISPQNYSVELILEQILRNLTFEEQKFLYQQLGEIYRER
QLMQS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggaaagggacacaagctctagtgatgtttctgcttctcatgtaggacgtgccaggcag
cgaagacgtcctactgaggctactgcagatgggaatagaaccaatggaccagctttgctt
gtcaatgatcagaataagtacaagtcaatgcttatccgtacatattctacagtatggatg
attggaggctttgtgttgatagtttatatgggtcacctctatatctgggccatggtggtt
gttattcaaatattcatggccaaagagctttttaacctactcagaaaatccagtgaagaa
aaacaactaccaggtttcaggctactgaattggcacttctttttcacagcaatgttgttt
acttatgggcgttttcttagtcgacagcttgttaacacagtaacttcagatcacttattg
tataaggttgtcagtggtctcataaagtatcagatgttcatttgctattttctttacatt
gctggatttgtctggtttattttgactctgaagaaaaagacatacaagtatcagttcaaa
caatatgcctggacgcacatgatccttttaacggtttttgcacaatcttcttttaccgtg
gcaaatatatttgaagggatgttctggtttctgttgcctgcttctctcattgtgattaac
gacattgctgcctatctatttgggttctttcttgggagaacacctctgatcaagttatct
ccaaagaaaacttgggaaggttttattggtgcatctgtgacaactatcatatctgctttt
gtgttagcaaatgtaatgggccgtttccaatggttgacatgcccaagaaaagacctgtcg
acagggtggcttcgttgtgaccctggtcctatgtttaagccagaacattattctttggga
gaatgggtgccaaaggggttcccttggaaggaagttgttcttttgcctgtgcagtggcat
gctttagcactaggtttgtttgcatcaataatagcaccttttggaggtttctttgcaagt
ggcttcaagagggcctttaaaataaaggattttggagacagcatacctgggcatggtggg
attactgaccgaatggattgtcagatggttatggcagtttttgcatacatatatcaccaa
tcattcatatcgccccaaaactactctgttgagctaatcttggaacagattctaagaaat
ctaacctttgaggagcagaaattcttatatcagcagcttggggaaatctaccgtgaaagg
caattaatgcagagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328160
Entry
4328160           CDS       T01015                                 
Name
(RefSeq) phosphatidate cytidylyltransferase 4, chloroplastic
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4328160
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4328160
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     4328160
SSDB
Motif
Pfam: CTP_transf_1 CarS-like
Other DBs
NCBI-GeneID: 4328160
NCBI-ProteinID: XP_015627526
LinkDB
Position
2:complement(1402707..1409397)
AA seq 383 aa
MAAAVATATTPAAAHLHHHHRHHRLPLLPSQPRPRPTLRLRLLIPTPPPLRRLLRRSPLL
AAAAVSADGGGGGGGGGEEAERKREKSRQLQKRVLVGVAIGVGAGGVVVAGGWVFAAAVA
AAVLAGAREYFGLVRGTAGGGGTPPPRFVSRVCSAICALMPILTLYYGHMDVTVTFSAFL
IAISLLLQRGNPRFAQLTSSVFGLFYCGYLPSFWVKLRSGLAAPALNTKIAYSWPILLGG
QAHWTVGLVATLISISSIIAADTSAFLCGRAFGRTPLTDISPKKTLEGALAGLTGCVLTT
VLLSSVLHWPRSLLSATAYGILIFLGSLFGDLVESLIKRDAGVKDSGSLIPGHGGMLDRV
DSYVFTGALCYSFIKVALPLFGV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggccgccgcggtggccacagcgacgacgccggccgccgcccacctccaccaccaccac
cgccaccaccgcctccccctcctcccctcccagccacgtccccgccccaccctccgcctc
cgcctcctcatcccgacaccaccccctctccgccgcctcctccgccgctccccgctcctc
gcggccgccgctgtctccgccgatggaggcggcggcgggggcggcggcggggaggaggcg
gagaggaagagggagaagtcgcggcagcttcagaagcgtgtgctcgtgggcgtcgccatc
ggggtgggcgcgggcggcgtcgtggtggccggcgggtgggtgttcgcggccgccgtggcc
gcggctgtcctcgccggagctcgtgagtacttcgggctcgtccgcgggaccgccggcggg
ggaggcacgccgccgccgcgcttcgtgtcccgcgtctgctctgccatctgcgctctcatg
cctatccttaccctgtactatgggcatatggatgttaccgtgacgttttctgcattcctt
attgcgatatcattgttattgcaaagaggaaatcctcgttttgcacagctgactagttca
gtttttggtctcttttattgtggctatcttccttctttctgggttaagctccgatctgga
ctagctgctcctgccttaaatacaaaaattgcatacagttggccaatacttcttggtggg
caagctcactggacagttggacttgtagcaaccttgatttctattagtagcattattgcc
gctgatacatctgctttcctttgtggacgggcatttggtcgcactcctcttactgatata
agccctaagaagaccttggagggtgctttagctggtctaactggctgtgtactgaccact
gtgcttctttcaagcgtcttacattggccaagatcgctgctgagtgctactgcttacgga
atcttgatctttctgggttcgttgttcggggatcttgtcgagtctctgatcaagcgtgat
gctggtgtgaaggactctggatcactcattcctggccatggtgggatgcttgaccgagta
gacagctatgttttcacaggggcactttgttactcattcatcaaagtagctttacctctc
tttggagtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348326
Entry
4348326           CDS       T01015                                 
Name
(RefSeq) phosphatidate cytidylyltransferase 1 isoform X1
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4348326
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4348326
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     4348326
SSDB
Motif
Pfam: CTP_transf_1 MgtC
Other DBs
NCBI-GeneID: 4348326
NCBI-ProteinID: XP_015612980
UniProt: Q0IYE6 Q8S601
LinkDB
Position
10:complement(9120529..9126506)
AA seq 430 aa
MPHVRSAAERDNGSGGDVTPGTPSPTHGARVRQRKRSSDAPSDVNKTNGANLLLNDQNKY
KSMLIRTYSSLWMMAGFVFLIYMGHLYIWAMVVVIQIFMASELFNLLRKANEDRQLPGFR
LLNWHFFFTAMLFAYGRFLSRQLVNTVTSDKLLYKLVSGLIKYQMFICYFLYIAGFVWFI
LTLKKKAYKYQFSQYAWTHMILLMVFAQSSFTVANIYEGMFWFLLPASLIAINDVAAYFF
GFFFGKTPLIKLSPKKTWEGFLGASVTTMLSAFVLANFMGHFQWLTCPRKDLSTGWLHCD
PGSIFTPESYDLPGWIPWREVAIMPIQWHALALGLFASIIAPFGGFFASGFKRAFKFKDF
GDSIPGHGGFTDRMDCQMVMAVFAYIYYQSFVMVQDLSVETIMEQILRNLTFEEQHDLYE
QLGKLLTRGN
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgccccatgttagatccgccgctgaaagggacaatggctctggtggtgatgtcaccccg
ggaactccaagcccgacccatggtgcccgtgtgaggcagcggaagcgctccagcgatgct
ccatctgacgtgaacaaaaccaatggcgctaatttgctgctaaatgaccagaacaagtac
aagtcaatgcttattcgcacgtattcttcgctctggatgatggcaggatttgtgtttttg
atatacatgggacatctatacatatgggctatggttgtcgttatccaaatctttatggcg
agtgagctcttcaatctgctgaggaaggccaacgaggacaggcagcttccagggttcaga
ctacttaactggcatttcttcttcactgcgatgctttttgcgtatggccgtttccttagt
cggcagcttgtcaacacggtgacttcagacaagttattgtacaagcttgtgagtggcttg
atcaagtaccaaatgtttatttgctactttctttatatagcagggtttgtatggtttatt
ctcactctaaagaaaaaggcgtacaagtatcaattcagtcaatatgcatggactcacatg
atcctattgatggtatttgcacagtcatctttcactgtggccaatatatatgaaggaatg
ttttggttcctcctaccagcttctttgatcgctatcaacgatgttgctgcatatttcttc
ggcttcttctttgggaaaacacccttaattaagctctctccaaaaaaaacttgggagggc
tttctaggtgcatcagtgactaccatgctttctgcatttgtgcttgctaatttcatgggt
catttccagtggttaacatgccccagaaaggatttgtcgactggatggcttcattgtgat
cctggctctatatttacaccagaaagttatgatttaccaggatggatcccttggcgagaa
gtggcaattatgcctattcagtggcatgccttagctcttggcttgtttgcttcaataata
gcaccatttggagggtttttcgctagtggttttaaaagagctttcaaattcaaggatttt
ggtgatagcatacctggccatggtggatttactgacaggatggattgtcaaatggttatg
gctgtgtttgcttatatctattaccaatcgtttgtgatggtacaggacttatctgttgag
acaatcatggagcagatactgagaaatctcacgttcgaggagcagcatgatctttacgag
caactaggcaagttactgacgagagggaactga

DBGET integrated database retrieval system