KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325332
Entry
4325332           CDS       T01015                                 
Name
(RefSeq) probable choline kinase 1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325332
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     4325332
    2.7.1.82  ethanolamine kinase
     4325332
SSDB
Motif
Pfam: Choline_kinase APH TCAD9 EcKL Haspin_kinase TFIID_30kDa Pkinase_fungal
Other DBs
NCBI-GeneID: 4325332
NCBI-ProteinID: XP_015650061
LinkDB
Position
1:4393565..4397180
AA seq 425 aa
MVAGSKELAAAMAPVTRPRWSVLPAPPRRLRWPPPPPAGIAAVCFGYRHRLRAAPPPTMV
AVDPPPREAAAAPPAMKRSASFDRVPEEARRILHRLAGELWGGDVDPAALAVSQLKGAMT
NEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPRLL
GRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREFHDLDMPGPKNVSLWQRLRRWLE
EARGRCSPEEARQFSLEKLGDEIAMLDIALSGVDQRVGFCHNDLQYGNIMIYEETRQVTL
IDYEYASFNPVAFDIANHFCEMSADYHSATPHVLDFTKYPGIDEQRRFVQTYLSSSGENP
SDAEVEHLLGLIAKYSLASHIFWGLWGIISGHVNKNIDFEYQEYARQRFDQYWKTKDQTL
GSKSN
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggtcgccggcagcaaggagctcgcggcggcgatggccccggtgacccggccgcgctgg
tcagtgctgccggcgccgcctcgtcgcctccggtggccgcccccgccgcccgccggaatc
gccgccgtctgcttcggctaccgacatcgcctccgcgccgcgccgccgccgacaatggtc
gccgtcgacccgccgccgcgggaggccgcggccgccccgcccgccatgaagcggagcgcg
agcttcgaccgcgtcccggaggaggcgcgccgcatcctgcaccgcctcgccggggagctc
tggggcggcgacgtcgaccccgccgcgctcgccgtgtcccagctcaagggcgccatgacc
aacgaggtgttccggatcacctggcccggcggcggcggcggcgagggcgagggcgagggc
gaccaccgcaaggtgctcgtccgcatctacggccagggcgtcgaggtcttcttcgaccgc
gccgacgaggtccgcaccttcgagtgcatgtcccgccacggccagggcccccgcctcctc
ggccgcttccccaacggccgcatcgaggagttcatcaacgcgaggacgctctccgcggcg
gatctgcgcgacgcggagatatcctcgctgatcgccaagaagcttcgtgaattccacgat
ctcgacatgcctggacccaagaacgtgtcactgtggcagaggctgaggaggtggcttgag
gaagctcgtggcaggtgctcgcccgaggaggctaggcagttcagtttggagaagctaggt
gatgagatcgcaatgctggacattgcattgtcaggggttgatcagagagtaggattttgc
cacaatgatctgcaatatggcaacattatgatatatgaagaaaccagacaagtgacctta
attgactacgagtatgcgagttttaatcctgtggcatttgacattgctaatcacttctgt
gagatgtctgctgattatcattcagccacacctcatgtgctggacttcacaaaataccct
ggcattgacgaacaacgcagatttgttcaaacgtacctcagctcttcaggtgagaaccca
tcagatgcggaagttgaacatttacttggcctgattgcaaaatacagtcttgcaagccat
atcttctggggtctttggggaataatctcagggcatgtgaacaagaacatcgacttcgag
taccaggagtatgcaaggcagcggttcgatcagtactggaagacaaaagatcaaacgctg
ggatccaaatccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325586
Entry
4325586           CDS       T01015                                 
Name
(RefSeq) probable choline kinase 2
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325586
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     4325586
    2.7.1.82  ethanolamine kinase
     4325586
SSDB
Motif
Pfam: Choline_kinase APH TCAD9 EcKL Pkinase Haspin_kinase
Other DBs
NCBI-GeneID: 4325586
NCBI-ProteinID: XP_015621301
UniProt: A2ZX88 Q5JMB6
LinkDB
Position
1:complement(29842827..29846837)
AA seq 368 aa
MVAIENQSQGQRAAEAAAQPRIPREARRLLHEMAASWADVADCRALQVIPLKGAMTNEVY
QVRWLNGAPATADGGEVEAEAAAREREVRKVLVRIYGDGVELFFDREDEVRTFECMSRHG
QGPRLLGRFTNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIWDR
LKNWLKTARNLCSSDESKKFRLGSLENEIAALEKEFSGDYHGIGFCHNDLQYGNIMIDED
TNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYLS
NSVSEEPDAEEVENLLQSIEKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQ
KKQALLTS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagagccagggccagcgggcggcggaggcggcggcgcagcca
cggatccccagggaggcgcggcggctactgcacgagatggcggcgtcgtgggcggacgtt
gccgactgccgggcgctgcaggtgattccgctcaagggcgccatgaccaacgaggtgtac
caggtgcgctggctcaacggcgccccggccaccgccgacggcggcgaggtggaggcggag
gcggccgcaagggagagggaggtgaggaaggtcctcgtgcggatatacggcgacggcgtg
gagctcttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtctcgccatggc
caaggcccccgcctcctcggccggttcaccaacggccgcgtcgaggagttcatccacgca
aggacactatctgcagcagaccttcgtgatcctgaaatttcagctctggtggcgtcaaaa
ctgagggaattccacaaccttgacatgcctggcccgaaatctgtactcatttgggaccga
ctgaaaaactggctcaaaactgcaaggaacctgtgctcatctgatgaatccaagaaattt
cggctgggtagcctggagaacgagattgctgcattggagaaagaattttcaggggattac
cacgggattggtttttgccacaacgatcttcagtatggcaacatcatgattgatgaagac
accaacatgttgactatcatcgattatgaatatgccagcttcaatccagttgcgtatgac
atcgctaatcatttctgcgagatggcagcagactatcattcagagaagccacatagactg
gactacagtaaatatccagacactgatgagcagaagcgttttgtgaagacgtacctaagc
aattctgtaagtgaagaacctgatgcggaagaggtggagaaccttctccaaagcattgag
aaatacacgctcgccagtcatctagtttggggcctctggggaataatatcggatcatgtc
aatgatattgacttcgactacaaggagtatgcaaggcagagattcgagcagtattggcag
aagaagcaagcacttttaacttcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268113
Entry
9268113           CDS       T01015                                 
Name
(RefSeq) probable choline kinase 2
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9268113
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     9268113
    2.7.1.82  ethanolamine kinase
     9268113
SSDB
Motif
Pfam: Choline_kinase APH EcKL TCAD9 DUF1679 Pkinase Haspin_kinase
Other DBs
NCBI-GeneID: 9268113
NCBI-ProteinID: XP_015638057
UniProt: C7J2C2
LinkDB
Position
5:26584512..26588371
AA seq 352 aa
MVASETNQKAAAAGSSIPEGARQLLHELAAGWGDVADCRALEVVPLRGAMTNEVYQARWP
PAAEAEAAGRRVLVRVYGEGVELFFDREAEVRTFESMSRHGHGPRLLGRFPNGRVEEFIH
ARTLSAVDLRDPEISAIIASKLREFHNLDMPGPKSVLIWDRLRNWLKTAKNLCPSDEAKE
FCLDSMENEITALENELSEDYQCVGFCHNDLQYGNIMIDEETKLLTIIDYEYASFGPVAY
DIANHFCEMAADYHSEKPHILDYTKYPDTDEQKQFVQSYLSSSGEEPDAEKVNNLIKSIE
KYTLASHLIWALWGIISEHVNDIDFDYMGYARQRFEQYWLKKPAILTCQVVE
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggtggcgagcgagacgaaccagaaggcggcggcggcggggagcagcatcccggagggg
gcgcggcagctgctgcacgagctggcggcggggtggggcgacgtggcggactgccgggcg
ctggaggtggtgccgctcaggggggccatgaccaacgaggtctaccaggcgcggtggccg
ccggcggcggaggcggaggcggcggggaggagggtgctggtgagggtgtacggcgagggc
gtggagttgttcttcgaccgggaggccgaggtgcgcacgttcgagtccatgtcgcggcac
ggccacggcccgcgcctcctcggtcgcttccccaacggccgcgtcgaggagttcatccac
gccaggacactctcagctgttgatctgcgtgatccagagatttcagccattatagcctca
aagctgagggaattccacaaccttgatatgcctggtccaaaatctgtactcatttgggac
agactaaggaactggctcaaaactgccaagaatttgtgcccctctgacgaagccaaagag
ttctgcttggatagcatggagaacgagatcactgcgttggaaaatgagctttcagaggat
taccagtgcgtaggattttgccacaacgatctccagtatggaaacatcatgattgatgaa
gagaccaaattgctgaccatcattgactatgagtatgcaagttttggtccagttgcttat
gacattgcaaaccatttctgcgagatggctgcagactaccattcagaaaagcctcacata
ctggactacactaaatatccagatactgatgagcagaagcaatttgtgcagagctacctg
agctcttcaggcgaggaacctgacgcagagaaggtcaataatctgataaaaagtatcgag
aagtacaccttggcaagccatctcatttgggccctctggggaataatttcggagcatgtc
aacgatattgacttcgactacatggggtatgcgaggcagaggttcgagcagtactggctc
aagaagcctgcaatcctaacatgtcaggtcgttgaataa

DBGET integrated database retrieval system