KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325353
Entry
4325353           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MSH7
  KO
K08737  DNA mismatch repair protein MSH6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4325353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325353
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     4325353
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II AAA_29 AAA_23
Other DBs
NCBI-GeneID: 4325353
NCBI-ProteinID: XP_015622469
UniProt: A0A0P0UZD3 Q5VR87
LinkDB
Position
1:complement(4234522..4244533)
AA seq 1224 aa
MQPRRRQQQQQSILSFLQKKPAAAAGEEGATPERPPRPPAASVAGIMERLVRPPRQQQQG
RDQDASQARHVEQRALPVKNQTTSNECSSALFLESCNAGDNKAAMLIAEEGSNMTPLQEP
LKSLWPSKDDFVRASTLSPELGLYQNLPPHCPKKLPFESSNNNCIGANSSFEEFDVQTPQ
DTSKTVFWRSSRGADTPLTESDSDQTPLQHPSKFSFVSPNGEYVRGATLFALDSNYTPRR
ESSEKLSSGPSDLPYIKATKLFTEFDSNGTPSQNHLKKLSSVPKNDKRIGAGAELFSEFD
PSPLKPETPVMRAVIPRLKRVQEDQRVTTNDSCSPFWGPNKKVKPAQCSPVENKVHDEMA
ESARSKFEWLNPSNIRDANRRRLADPLYDKTTLFIPPDALRKMSTSQKQYWNIKCKYMDV
VLFFKVGKFYELYEVDAEIGQKELDWKMTISGVGKCRQVGISESGIDVAVEKLLARGYKV
GRIEQMESADQAKSRGSNSVILRKLVHVSTPSTVGDSNIGADAVHLLSLKEITLASNGSR
VYGFAFLDYAALKIWVGSVHDDDTFAALGALLVQVSPKEIIYETSGLSKETHRLIKKYAS
AGSVKMQLTPLYGLYFSDVSEIQTLIDSRGYFKASTSSWLSALNSSVNKDAVICALGGLV
SHLTRLMLEDALKNGEVLAYHVYRTCLRMDGQTLVNLEIFSNNFDGGSSGTLYKHLNHCI
TPCGKRLLRRWICHPLKDIDAINERLDIVEGFIQNCGLGSVTLEHLRKVPDLERLLGRVK
STVGLSSAVLLPFVGEKILKRRIKTFGMLVKGLRVGIDLLDILQRQDHGISALSKAVDIP
TLSSLGELIHHFEEAIDDDFPRYQDHSVKDDDANTLAMLVDLLVGKASEWSLVINALSTI
DVLRSFAAMALSSFGTTCRPNILLKGKAPVLQMKGLWHPYAFAESVNGLVPNDLSLGQNL
SGQNRFALLLTGPNMGGKSTIMRATCLAIVLAQLGCYVPCQSCELTLADAIFTRIGAMDR
IMSGESTFLVECTETASILENATEDSLVLLDELGRGTSTFDGYAIAYAVFRHLVEAVRCR
LLFATHYHPLTKEFASHPHVTLQHMACMLKPRNGGDGGEKELTFLYRLTSGACPESYGLQ
VATMAGLPRSIVERASAAGEMMRSKIAGNFRSSEERAEFSTLHEEWVRTIVAIGGVKDAH
LDEDTMDTLFCVFHELKAHFRKRR
NT seq 3675 nt   +upstreamnt  +downstreamnt
atgcagccgcggcggcggcagcagcagcagcagtcgatcctctccttcctccagaagaag
ccggcggcggcggcgggggaggagggcgcgacgcccgagaggcccccgcggcctcccgcc
gcgtcggtcgcggggatcatggagaggctcgtgcggccgccgcggcagcagcagcagggg
agagaccaggatgcttcccaggctagacatgtggagcagagagccttacctgtgaaaaat
caaactacttcaaatgagtgctcaagtgcattgttcttagaatcttgcaatgctggagat
aacaaagcagccatgttgattgcagaagaaggttcgaatatgactcctttgcaggagccc
ctgaagtccttatggccttccaaagatgactttgttagagcaagcacactgtccccggaa
cttggtttatatcaaaatcttccaccgcattgtccaaagaagttaccctttgagtcttcc
aataataactgcattggagctaattcatcatttgaagagtttgacgtacaaactcctcag
gatacttcaaaaacagtcttctggagatcttctcgtggagctgatacacctttaacagaa
tctgattcagatcaaactcctttgcagcatccatcaaagttctcatttgtatctcctaat
ggtgaatatgtccggggcgctacactgtttgcacttgattccaattatactcctagacga
gaatcctcagagaagcttagttctgggccttcagaccttccatacattaaagcaacaaaa
ttatttacagaatttgattcaaatggaacaccatcacagaaccatctgaaaaagttatcc
tcagtgcctaagaatgacaaacgcattggagcaggtgctgaactattttcggaatttgat
ccgagtcccctgaaaccagaaacaccagtgatgcgagcagtaattcctcgtctgaagcgg
gttcaagaagatcaacgtgtgactaccaacgactcatgctctcctttctggggtccaaac
aagaaggtgaaaccagctcagtgttctccagttgagaataaggtccatgatgaaatggct
gaaagtgcacgcagcaagtttgagtggctgaatccttcgaatatcagagatgcaaataga
aggcggctggcagacccactttatgataagacaactctttttattccacctgatgcattg
agaaagatgtctacatctcaaaagcaatattggaatattaagtgcaagtatatggatgtt
gttttgtttttcaaagtgggaaaattctatgagctctatgaggtggatgctgagattggc
caaaaggaacttgactggaaaatgactatcagtggggtgggaaagtgccggcaggttggc
atttcagaaagtgggatagatgttgccgttgaaaagcttttagctcgagggtataaagtt
ggcagaattgaacaaatggaatctgcagaccaagccaaatctagaggatcaaattcggtt
attctaagaaaattggttcatgtatccacaccatcaacagtaggggacagcaacattggg
gctgatgctgttcaccttctttcactcaaagagattacactagcttcaaatggttcccgg
gtctatggatttgcatttttagattatgctgcacttaaaatttgggtgggttcagtccat
gatgatgatacatttgcagctttgggggctctgctggtgcaggtctctccgaaagaaata
atctatgaaacctcaggcctttcaaaagaaactcatagattaattaagaaatatgcttca
gcaggttctgtgaaaatgcagctgaccccactatatgggttatatttctctgacgtttca
gaaattcaaacgttaatagattctagaggatactttaaagcgtcaacaagttcatggtta
tctgcattgaattcttcagtgaataaagatgcagttatttgtgcactcggtggacttgtg
agccatttaactagacttatgctagaggatgctctgaaaaacggggaggtcttagcctac
catgtatacagaacatgtctaagaatggatggtcagactcttgtgaaccttgagattttc
agcaacaactttgatggtggttcatcaggtaccttatataagcacctcaatcactgcata
actccatgcggtaagcggcttctaagaagatggatttgccacccactaaaagatattgat
gctatcaatgaaaggctcgacattgttgagggcttcattcaaaattgtgggctaggatct
gttacactagagcatctacgtaaagtccctgatctcgagaggttactaggacgagtaaaa
tccactgttggtttatcatctgcggttctgttgccctttgttggagaaaagatattaaaa
agaaggataaaaacgtttggcatgcttgtcaagggcctccgtgttggaattgacttacta
gacatcctacaaagacaagatcatggcatctcagcattgtcaaaggctgtggatattcca
acattgagctcccttggtgaattaattcatcattttgaagaggcaatagatgatgatttt
ccaagataccaggatcatagtgtcaaagacgatgatgcaaacactttggctatgctagtg
gatcttttagttggaaaagcttctgaatggtctctagtgatcaatgctctgagcactatc
gatgtgcttaggtcctttgcagccatggcattgtcgtcatttggcacaacgtgcagaccg
aacattctgctgaaaggaaaagcgcctgtacttcagatgaagggtttatggcatccttat
gcttttgcagaaagtgtaaatgggttggtaccaaatgatctatctcttggtcagaattta
tctggccaaaatcgctttgcattgttgttgactggtccaaatatgggcgggaaatctaca
ataatgcgtgccacctgcctagctattgtgcttgcccagctcggctgttatgttccctgt
cagtcatgcgagttgacacttgcagatgccatatttacacggattggtgcaatggatcgg
attatgtctggagaaagtacctttcttgtcgaatgcactgagactgcatctattcttgag
aatgcaaccgaggattctctcgtcttgcttgatgagcttggcagaggaactagcacattt
gatggatatgcaattgcatatgcagtattccgacaccttgtcgaagcggtccgatgccgt
ctgctcttcgcaactcactaccatcctctcaccaaggagttcgcctctcacccccacgtc
acccttcagcacatggcctgcatgctgaagccaagaaacggcggcgacggcggcgagaag
gagctcaccttcctctaccggctcacctcgggcgcctgcccggagagctacggcctgcag
gtcgccaccatggcagggctcccgaggtcgatcgtggagagggcgtcggccgccggcgag
atgatgaggtcgaagatcgccgggaacttcaggtcgagcgaggagcgtgcggagttctcg
accctccatgaggagtgggtgaggacgatcgtggcgatcggcggcgtgaaggacgcgcac
ctggacgaggacaccatggacacgctgttctgcgtcttccatgagctgaaggctcacttc
aggaaacggaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347016
Entry
4347016           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MSH6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4347016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347016
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     4347016
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II LBR_tudor Cadherin_2 TFCD_C
Other DBs
NCBI-GeneID: 4347016
NCBI-ProteinID: XP_015611811
LinkDB
Position
9:14378042..14387301
AA seq 1283 aa
MASPSSRRLSNGRSPLLRKQSQITAFFSSPTAKPSPSPLNPRATKPPLAVPSPPPPNPPS
PPQEEETAVGRRLRVYWPLDDAWYEGRVEGYDVGSRRHRVRYDDGEEEVVDLASERYEWA
AAADEEEVTPQPSRKLRRLRRMSDAATAKSPGAVDGGGGGDETADSAEEEDEDWKNDAAA
ENDSEEVELDDEEDDEEEVVAVKTRKGKKNNPLSTSASTPKLASGLGSASISGSTLSKKR
RKVDAGALDCAKKFSFEPANTTGKVELKVPISCSQREQPLENALTALTGEVAERFAQRQA
EKFKFLGEGRKDAKGRRPGNPNYDPRTLSLPSQFLNSLTGGQRQWWEFKSQHMDKVLFFK
MGKFYELFEMDAHVGAKELDLQYMKGDKPHCGFPEKNFELNLEKLAKKGYRVLVIEQTET
PEQLDLRRKETGVKDKVVRREICAMVTKGTLTEGESLLANPDPSYLFSVAESYQCGSEKD
QDGHTIGVCIVDVSTSKFIVGQFQDDAERHGLCSILSEIRPAEIIKPAKMLSPETEKALK
SNTRDPLINNLLPSMEFWDAEKTIHEIKQYYCSLDTPGAGAQISSAYLPELLSELIEAGD
KTYALSALGGSLFYLRQSLLDEKLLPCAEFERLTCSGLTNPIRKHMILDAAALENLEILE
NARNGGLSGTLYAQLNHCVTGFGKRLLKRWIARPLYERQAILQRQSAIATFKGSGHECAI
QFRKDLSRLPDMERLLARLFSSCDKNGRSSKSVVLYEDASKRLLHQFTAALRGCQQMFQA
CSSISMLTSTDGSSLLNDLLSLGKGLPHVSSILDHFRDAFDWSEADRNGRIIPHEGCDPQ
YDAACIAIEEIESSLQKYLKEQRKLLSDSSVKYVDVGKDTYLLEVSENLRGSVPHNYELQ
STKKGFYRYWTPEVKELISELSKAEAEKEAKLKCILQNLIQLFVEHHSKWRQLVSVVAEL
DVLISLAIASDFFEGPTCCPIIKESYGPDDTPTLHARNLGHPTLRSDSLGSGSFVPNDIK
MGGPGNASFIVLTGPNMGGKSTLLRQVCLTIILAQIGANVPAESFELSLVDRMFVRMGAR
DHIMAGQSTFLVELMETASVLSSATKNSLVALDELGRGTSTSDGQAIAASVLEYLVHHVQ
CLGLFSTHYHRLAAENKDSKVSLCHMACEISKGEGGLEEVTFLYKLTPGSCPKSYGVNVA
RLAGIPASVLQRANEKSSDFEASYGKRPGITKNKPSCAQEDKFAAIKDLFRVVKAMHHRE
DHASSLGMLHEVQKRAKVQVIGE
NT seq 3852 nt   +upstreamnt  +downstreamnt
atggcgtcgccgtcgtcgcgccgcctcagcaacggccgctccccgctcctccgcaagcag
agccagatcaccgccttcttctcctcccccaccgccaagccctcgccctcgccgctgaac
cctagggcgacgaagccccctctcgccgtcccctcccctccccctcccaacccgccatcc
ccgccgcaggaggaggagacggcggtggggaggcggctgcgggtgtactggccgctggac
gacgcgtggtacgaggggagggtggagggctacgacgtggggtccaggcggcaccgcgtc
aggtacgacgacggcgaggaggaggtggtggacctcgcgagcgagaggtacgagtgggcc
gccgccgccgatgaggaggaggtgaccccgcagccgtcgaggaagctgcggcggctccgg
cggatgtcggatgccgcaacggccaagtcacctggtgcggtggatggtggtgggggtggg
gatgagactgcggattccgctgaggaggaggacgaggactggaagaatgatgctgcggca
gagaatgattcggaggaggtggagctggatgatgaagaagacgatgaggaggaggttgtt
gctgtgaaaacaagaaagggaaagaaaaataaccctttgtcgacgtcggcttcgacgcca
aaattagcatccggtttgggctcggcttctatttcagggtccacattgtcgaagaagagg
agaaaagtcgatgcgggtgcgttggactgcgctaaaaagttcagctttgaaccagctaat
accactggaaaagtcgaattgaaagtgccaatcagctgtagccagagggagcagccgtta
gagaatgctctcaccgctcttactggagaggtcgccgagcgctttgcgcagcggcaagca
gaaaagtttaaattccttggggaagggcgtaaggatgcgaaagggagacgacccggaaac
cccaactatgatcctagaactctttccttgccttcccagttcttgaatagcttgacaggc
ggacagaggcaatggtgggaatttaaatcacagcacatggataaagttctgttcttcaag
atgggcaaattctatgaattatttgaaatggatgcacatgttggggcaaaggagcttgat
cttcagtatatgaagggtgacaagcctcactgtggattcccggagaagaattttgaattg
aatttggagaaattagctaagaagggttatcgagttctggttatcgagcagactgaaaca
ccggagcagcttgacctccgccgtaaagaaactggtgtaaaagacaaggttgtgaggcgt
gaaatatgtgcaatggtcacaaaaggaacattgacagaaggggagtctctgctggcaaat
ccagatccatcatatctattttctgtggctgaaagttatcagtgtggttcagagaaggat
caagatggtcatacaattggtgtttgcatagttgatgtttcaacaagcaaatttattgta
ggacagttccaagatgatgctgaacgccatgggctatgttctattttatctgagattagg
cctgcagaaatcataaaaccagctaaaatgttgagtccagaaactgagaaagcactgaag
agcaatacgagagaccctttaataaacaatttgcttccatccatggagttctgggatgca
gagaaaactattcatgaaataaagcaatactattgctcattggacacacctggtgccggt
gcacaaatcagttctgcctatctgcctgagctattgagtgagctaattgaagcgggagac
aaaacatatgcactttctgctcttggtggttctttgttttatttaaggcaatcccttctg
gatgagaaattgcttccatgtgctgagtttgagcgccttacatgctcagggctcaccaac
cctatccgcaagcatatgatacttgatgcggcagcattggaaaatctggaaattttagaa
aatgcaagaaatggtggtctctcagggacattgtatgcgcagttaaatcattgtgttact
ggatttggaaaaaggttgcttaaaaggtggattgcaaggccattgtatgaacgccaggca
atactacagcgtcaaagtgccatcgctactttcaagggatctgggcatgaatgtgctatc
caattccgtaaggatctgtctcggcttccagacatggagcgcctacttgcacgccttttt
tctagctgtgataagaatggaagaagttcaaagtcagttgttctttatgaagatgcatca
aagagactgcttcatcagtttactgctgctcttcgtggttgccagcagatgttccaagca
tgctcttctattagtatgttgacaagcacagatggatcttctctattaaatgatttgtta
tcactaggcaaagggctaccacatgtttcttctattctggaccacttcagagatgcattt
gattggtcagaagcagacaggaatggtcggatcatacctcatgaaggttgtgatcctcaa
tatgatgctgcttgcattgcaattgaggagattgaatccagtcttcaaaaatacctgaag
gaacaaagaaagctattgagtgattcatcggtaaaatatgtagatgttggaaaggatacg
tacctccttgaagtgtctgagaacctgcgaggttctgttccccataactatgagttgcag
tctacaaaaaagggtttctatcggtactggacgccagaagtaaaagaattaatatcagaa
ctttctaaggctgaggcagagaaagaggcaaaattgaaatgcattcttcagaatctgatt
caactctttgttgagcatcacagcaagtggagacaattggtttctgtagttgctgagctt
gatgttttgattagtcttgctattgccagtgatttttttgagggaccaacttgctgtcca
attatcaaagaatcatatggtccagatgatactcctactctccatgcaagaaatttaggg
caccccaccctccgaagtgattctttaggcagtggatcttttgtacccaatgacattaag
atgggtgggcctggaaatgccagctttattgttcttactggcccaaatatgggtggaaaa
tcaactcttttgcgtcaagtttgtcttaccataattttggcacagattggagcaaatgtt
cctgctgaaagctttgaactttctcttgttgaccgtatgtttgttcgaatgggagcaagg
gatcatattatggctgggcaaagtacgttcttagtggagctcatggaaactgcttctgtg
ctttcatcagcaaccaagaattctcttgtggctttagatgagcttgggcgcggtacatca
acctctgatggacaagctattgcggcatctgttctagaatatctagttcatcatgtgcag
tgcctaggcttattttcaacacactaccataggttagcagcagaaaataaggatagcaag
gtatcactctgccatatggcatgtgagataagcaagggagaaggaggtttggaagaagtt
actttcctctacaagttaacgcctggttcatgccccaaaagctatggtgtaaatgttgct
cgattggcaggaatacctgcatcagtgcttcaaagggctaatgagaagtcaagtgacttc
gaggccagttacgggaagcgacccggtataacaaagaataagcccagctgtgcacaggag
gataaatttgccgccatcaaggatctgttccgcgtcgtgaaggcaatgcatcatcgggag
gatcatgcatcaagtttaggcatgctccatgaagtgcagaagcgtgctaaggtgcaggtc
attggagaataa

DBGET integrated database retrieval system