KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325375
Entry
4325375           CDS       T01015                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic-like
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4325375
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4325375
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     4325375
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 4325375
NCBI-ProteinID: XP_015618511
UniProt: A2ZW27
LinkDB
Position
1:26392155..26396061
AA seq 581 aa
MAAATSTSSTALAHPKTLNPASKSAAAGSVSFPAAQPPCPLAASAGGRRRRGAVAAKVSS
PQVIGATMPSLDFETSVFKKEKVSLAGHDEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGS
QGPAQAQNLRDSLAEAKSDIVVKIGLRKGSKSFEEARAAGFTEESGTLGDIWETISSSDL
LLLLISDAAQADNYEEIFSHMKPNSILGLSHGFLLGHLQSVGLDFPKNISVVAVCPKGMG
PSVRRLYVQGKEVNGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYRSD
IFGERGILLGAVHGIVEALFRRYTEHGLDEDSAYKNTVECITGIISKTISKKGMLEVYNS
LTEEGKKQFIEAYSAAYYPCMDILYECYEDVSSGSEIRSVVLAGRRFYEKEGLPAFPMGN
IDQTRMWKVGERVRSTRPAGDLGPLHPFTAGVYVALMMAQIEVLRKKGHSYSEIINESLI
ESVDSLNPFMHARGVAFMVDNCSTTARLGSRKWAPRFDYILTQQAFVTVDKNAPVNQDLI
SNFFSDPVHSAIEVCAQLRPTVDISVPADADFVRPELRQSS
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggcggcggccacctccacttcctccaccgcgctcgcccaccccaaaaccctaaacccc
gcctccaaatccgcggccgccggctcggtctccttccccgccgcccagcccccatgcccc
ctcgccgcctccgccggcggccgccgccgccgcggcgccgtggccgccaaggtctcgtcg
ccgcaggtgatcggggccaccatgccgtcgctggacttcgagacatccgtcttcaagaag
gagaaggtgtctctagctggccatgacgagtatattgtgaggggcgggaggaatctgttc
ccgctgctgccggaggcgttcaaggggatcaagcagatcggcgtaatcggatggggttct
cagggtcctgcacaagctcagaacctgagggactcacttgctgaggcaaaatcagacatc
gttgttaagattggtctccggaaaggttctaaatcttttgaagaagcacgcgcagctgga
tttactgaagagagtgggacacttggagatatatgggagactatctcaagtagcgatctt
ttgttgttgttgatatcagatgctgctcaggcggataactatgaggaaattttctcacac
atgaaacccaacagtattcttggattgtcacatggatttctccttggacatttgcaatct
gttggccttgatttccctaaaaacatcagtgttgttgctgtgtgtcccaagggaatgggc
ccatcagttagaaggctttatgttcagggaaaagaagtaaacggtgctggtatcaactcc
agctttgctgtacaccaggatgttgatggaagagcaacagatgtcgctcttggatggtca
gttgctctaggttctcctttcacatttgctactactctagagcaggagtaccgaagcgat
atttttggcgagcgaggtattttgcttggggctgtacatggtattgtggaggctcttttc
aggagatacacagagcatgggttggatgaggactcagcatacaagaacactgttgagtgc
atcactggaatcatctctaaaactatttcgaaaaaggggatgcttgaagtgtacaattca
ttgacagaagaaggaaagaagcaatttatcgaggcttacagtgcagcatattatccatgc
atggatatactatatgaatgctatgaagatgtttcttctggaagtgaaattagaagtgtt
gttttggctggaaggagattttatgaaaaggaaggacttcctgctttcccgatgggcaac
attgatcaaacacgtatgtggaaggtgggtgaaagggtgcggtcaacacggccagcaggt
gatcttggcccattacatcctttcactgctggagtgtatgttgcacttatgatggcacag
attgaagtccttagaaagaagggccactcttactcggagatcatcaacgagagtttgatc
gagtctgtggattccctgaacccattcatgcacgctcgtggggtggccttcatggttgat
aactgctccacaacagcccggttgggatcaaggaaatgggcgccacgcttcgactacatc
ttgacccaacaagcttttgtgactgttgacaagaatgctccagttaatcaagacctcatc
agcaatttcttctccgatcccgtccatagtgccattgaagtctgtgctcagttgaggccc
accgttgacatttcagtgcctgctgatgcagactttgtgcgtccagagctgcgacaatct
tcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339677
Entry
4339677           CDS       T01015                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
osa_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4339677
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4339677
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     4339677
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 4339677
NCBI-ProteinID: XP_015640421
UniProt: Q65XK0
Structure
LinkDB
Position
5:complement(28579254..28582614)
AA seq 578 aa
MAASTTLALSHPKTLAAAAAAAPKAPTAPAAVSFPVSHAACAPLAARRRAVTAMVAAPPA
VGAAMPSLDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGP
AQAQNLRDSLAEAKSDIVVKIGLRKGSKSFDEARAAGFTEESGTLGDIWETVSGSDLVLL
LISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSAGLDFPKNISVIAVCPKGMGPSV
RRLYVQGKEINGAGINSSFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFG
ERGILLGAVHGIVEALFRRYTEQGMDEEMAYKNTVEGITGIISKTISKKGMLEVYNSLTE
EGKKEFNKAYSASFYPCMDILYECYEDVASGSEIRSVVLAGRRFYEKEGLPAFPMGNIDQ
TRMWKVGEKVRSTRPENDLGPLHPFTAGVYVALMMAQIEVLRKKGHSYSEIINESVIESV
DSLNPFMHARGVAFMVDNCSTTARLGSRKWAPRFDYILTQQAFVTVDKDAPINQDLISNF
MSDPVHGAIEVCAELRPTVDISVPANADFVRPELRQSS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggcggcctcgaccaccctcgccttatcccaccccaaaaccctagccgccgccgccgcc
gcggcccccaaggccccgacggcgccggccgccgtctccttcccggtctcacatgccgcc
tgcgcgccgctcgccgcccgacgccgcgcggtcaccgccatggtcgcggcgccgccggcc
gtcggggccgccatgccgtcgctcgacttcgacacatccgtcttcaacaaggagaaggtc
tccctcgccggccacgaggagtatatcgtgaggggtgggaggaacctgttcccgctgctt
cccgaggcgttcaagggcatcaagcagatcggagtgattggatggggctctcaggggcct
gcacaagcccagaacctgagggattcactagctgaagcgaagtctgacattgttgttaag
attggtctccggaaaggctctaagtcatttgatgaagcacgtgctgctggctttactgaa
gagagtggaaccttgggtgatatttgggagactgtttctggcagcgacctcgtgttgctg
ttgatatcagacgctgcacaggcagacaactatgagaaaatcttctctcacatgaaacca
aacagtattcttggtttatcacatggatttttgcttggacatttgcaatctgctggcctt
gatttcccaaaaaatatcagcgtgattgctgtatgccccaagggaatgggtccatccgtt
cggaggttatacgtacaaggcaaagaaattaatggtgctggtatcaactctagttttgct
gttcaccaggatgttgatggaagggcaactgatgttgctctaggatggtcagttgcgctg
ggatctcccttcacatttgctactaccttagaacaggagtacaagagcgatatctttggg
gagcgaggcattcttcttggagctgttcatggcatcgtggaggctctgtttaggagatac
acagagcaaggaatggatgaagaaatggcatacaaaaacaccgtagagggcatcactgga
attatctcgaaaactatctcaaagaagggaatgcttgaagtgtacaactccttgacagag
gaggggaagaaggaattcaacaaggcctacagtgcatcattctatccttgcatggacata
ctctatgagtgctacgaagatgttgcctctggaagtgaaatccggagtgttgtgttggct
ggacggagattttacgagaaggaaggccttcctgctttccctatgggcaacatcgaccaa
actcgtatgtggaaggttggtgaaaaggtgcggtcaacccgaccagaaaacgatcttggc
cccctgcatcccttcactgctggagtctacgttgcactgatgatggctcagatcgaggtc
cttagaaagaagggtcactcctactcagagatcatcaacgagagcgtcatcgagtccgtg
gactcactgaaccccttcatgcatgctcgtggagtggccttcatggttgacaactgctca
acgacggctcgtctgggatcaaggaaatgggcgccacgcttcgactacatcctgacccag
caagcattcgtgacagtggacaaggatgctcccatcaaccaggacctcatcagcaacttc
atgtccgaccccgtccatggcgcaatcgaggtgtgcgctgagctgcggcccaccgtcgac
atctccgtgcctgccaacgccgatttcgtgcgcccagagctccggcagtcatcgtag

DBGET integrated database retrieval system