KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325407
Entry
4325407           CDS       T01015                                 
Name
(RefSeq) non-specific phospholipase C2
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4325407
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325407
   00565 Ether lipid metabolism
    4325407
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:osa02042]
    4325407
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     4325407
Bacterial toxins [BR:osa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   4325407
SSDB
Motif
Pfam: Phosphoesterase
Other DBs
NCBI-GeneID: 4325407
NCBI-ProteinID: XP_015623428
UniProt: Q8RYK2 A0A0P0VD16
LinkDB
Position
1:complement(42063219..42067808)
AA seq 520 aa
MAVRRRRPGPVAAAVLLLLAVATQAAASPIKTVVVVVMENRSFDHMLGWMKRLNPEIDGV
TGGEWNPTNASDPSSGRVYFGEGAEYVDPDPGHSFQEIRQQIFGSDDASGPARMDGFVQQ
ARSLGDNMTAAVMNGFSPDSVAVYRELVGEFAVFDRWFASVPSSTQPNRLFVHSATSGGA
TSNNPELLAKGYPQRTIFDNVHDAGLSFGVYYQDVPAVLFYRNLRKLKYLTKFHPFHGAF
RDHAARGSLPNYAVVEQHYMDSKSHPANDDHPSHDVFQGQMLVKEVYETLRASPQWNQTL
MVVTYDEHGGFYDHVPTPVTGVPSPDGIVGPPPYNFAFDRLGVRVPAIVISPWINKGTVV
HGPNGSPTATSEYEHSSIPATVKKLFDLPQDFLTKRDAWAGTFESVVQGRTEPRTDCPEQ
LPMPMRIRLTEANEEAKLSEFQQELVQLASVLNGDHQLSSLQDTIRDRMNVREGIAYMRG
AVKRFFETGMSAKRMGVDDEQIVKMRPSLTTRTSPAIEQP
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggttcgccgccggcgacccggccccgtggcggccgccgtgctgctgctactcgcg
gtggcgacccaggcggcggcgagcccgataaagacggtggtggtggtggtgatggagaac
cggtcgttcgaccacatgctggggtggatgaagcggctgaacccggagatcgacggcgtg
accggcggcgagtggaacccgacgaacgccagcgacccgtcgtcggggcgcgtctacttc
ggcgagggcgccgagtacgtggacccagacccgggccactcgttccaggagatccggcag
cagatattcgggtcggacgacgcgtcggggccggcgaggatggacggcttcgtgcagcag
gcgcggtcgctgggggacaacatgacggcggccgtcatgaacggcttctcgccggacagc
gtcgccgtgtaccgggagctcgtcggggagttcgcggtgttcgaccggtggttcgcgtcc
gtgccgtcgtcgacgcagcccaaccgactgttcgtgcactccgccacatccggcggcgcc
accagcaacaacccagagctgctggcgaagggctacccgcagcgtacaatcttcgacaac
gtgcacgacgccgggctgtcgttcggggtctactaccaggacgtgccggcggtgctcttc
taccgcaacctgcggaagctcaagtacctgaccaagttccacccgttccacggcgcgttc
cgcgaccacgccgcccgcggctccctcccaaactacgccgtggtggagcagcactacatg
gactccaagtcccacccggccaacgacgaccacccgtcgcacgacgtcttccagggccag
atgctcgtcaaggaggtgtacgagacgctccgcgccagcccgcagtggaaccagacgctc
atggtcgtcacctacgacgagcacggcggcttctacgaccatgtccccacccccgtcacc
ggcgtccccagccccgacggcatcgtcggcccgccgccgtataacttcgcctttgatcgc
ctcggcgtccgtgtcccagccatcgtcatctccccctggatcaacaagggtacagttgtt
catgggccaaacgggagcccaaccgcgacgtcggagtacgagcactcgtccatccccgcg
accgtgaagaaactcttcgatctgccacaggatttcctgactaaaagggacgcctgggct
ggaacgtttgagagtgtcgtgcaaggcagaactgagccaaggacggattgcccagagcaa
ctcccaatgccgatgaggatacggctgacggaggcgaacgaggaggcgaagctgagtgag
ttccagcaggagctggttcagctggcgtcggtgctcaacggggaccaccagctgagcagc
ctgcaggacacgatcagggacaggatgaacgtcagggaaggcatcgcgtacatgcggggc
gctgtaaagcgcttcttcgagaccggcatgtcagccaagaggatgggcgtcgacgacgag
cagatcgtcaagatgaggccatcgctcaccaccaggacatcccctgcgatcgagcaacca
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326465
Entry
4326465           CDS       T01015                                 
Name
(RefSeq) non-specific phospholipase C6
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4326465
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4326465
   00565 Ether lipid metabolism
    4326465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:osa02042]
    4326465
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     4326465
Bacterial toxins [BR:osa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   4326465
SSDB
Motif
Pfam: Phosphoesterase
Other DBs
NCBI-GeneID: 4326465
NCBI-ProteinID: XP_015633975
LinkDB
Position
1:complement(89664..91683)
AA seq 547 aa
MWPLSPHRRHLQQHGHSGAMGRRLLLLFLMLAQAPNSNGDSKIKNVVVLALENRSFDHML
GWMQRLLGLPIDGLTGAECNPAPGPGPADSLLHCVSPDADLVVPDDPAHAFEDVLEQLLG
FRPNDSTGAAASPSDMSGFVRSAVSVSALLTDAVMRGFTPSRLPAFSALASSFAVFDRWF
SSIPGPTQPNRLFLYSATSHGAVAHDKWNLLRGYPQRTIFDSLAADALDYRVYFKTIPTT
LFYRRLRTVANAARGTFRRYDAAFRDHARRGLLPALSVIEPRYFDLTGTPADDDHPAHDV
ANGQRLVKDVYEALRAGPQWNHTLLIITYDEHGGFYDHVPPPNVGVPSPDAIRGPLPFFF
RFDRLGVRVPTIMVSPWIRKGTVVGRPPGGPTPTSEYEHSSIPATIKKIFNLSSDFLTRR
DAWAGTFEHLFTDLDEPRTDCPETLPEIPPPSSSSSSTKKEDGGWLSDFQRELVQLAAFL
NGDYMLSSFAQEYESRMTMTVKQADAYVRRAVKSFLEASKRAKRLGANDSAIVTMRPSLT
TATTCCP
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtggccgctctctcctcaccgacggcatctccagcagcacgggcattccggcgccatg
ggtcggcggctgttgctgctcttcctaatgctggcacaggcacccaattccaatggggat
tccaagataaagaacgtggtggtgttggcgctggagaaccggtcgttcgaccacatgctg
gggtggatgcagcggctgctgggcctccccatcgacggcctcaccggcgcagagtgcaac
ccggctccaggaccaggtccagccgactccctcctccactgcgtctcccccgacgccgac
ctcgtcgtccccgacgaccccgcccacgccttcgaggacgtcctcgagcagctgctgggg
ttccgacccaatgactctactggcgccgccgcctccccctcagacatgtcgggcttcgtc
cgcagcgccgtctccgtgagcgcgctcctgaccgacgccgtcatgcgggggttcaccccg
tcgcggctcccggccttctccgcgctggcctcctccttcgcggtgttcgaccgctggttc
tcctccatcccggggcccacgcagcccaaccggctgttcctctactccgccacctcccac
ggcgccgtcgcccacgacaagtggaacctcctccgcggctacccgcagcgcaccatcttt
gactccctcgccgccgacgccctcgactaccgggtctacttcaagaccatccccaccacc
ctcttctaccgccgcctccgcaccgtcgccaacgccgcccgcggcaccttccgccgctac
gacgccgccttccgcgaccacgcccgcaggggcctcctcccggcgctctccgtcatcgag
ccacgctacttcgacctcaccggcacgcccgccgacgacgaccacccggcgcacgacgtc
gccaacggccagaggctggtcaaggacgtctacgaggcgctgcgggcgggcccgcagtgg
aaccacacactgctcatcatcacctacgacgagcacggcggcttctacgaccacgtcccg
ccgcccaatgtcggcgtccccagccccgacgccatccgtggcccgctgcccttcttcttc
aggttcgaccgcctcggcgtcagggtgcccaccatcatggtgtcgccgtggatcaggaaa
gggacggtggtggggaggccgccgggagggccaacgcccacgtccgagtacgagcactcc
tccatcccggccaccatcaagaagatattcaacctcagctccgacttcctcaccaggagg
gatgcgtgggcgggcaccttcgagcacctcttcacggacctggacgagccaaggacggat
tgcccggagacattgccggagatcccgccgccatcttcctcgtcgtcgtcgaccaagaaa
gaagacggaggatggctgtcggacttccagcgcgagctggtgcagctggcggccttcctc
aacggcgactacatgctgtcaagcttcgcacaggagtacgagtcgagaatgacgatgacg
gtgaagcaggcggatgcgtatgtgaggcgagccgtcaaaagtttcctggaggccagcaag
cgggccaaacgcttaggtgcaaacgactccgccattgtaaccatgagaccatccctcact
actgcaaccacctgctgcccttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334641
Entry
4334641           CDS       T01015                                 
Name
(RefSeq) non-specific phospholipase C1
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4334641
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4334641
   00565 Ether lipid metabolism
    4334641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:osa02042]
    4334641
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     4334641
Bacterial toxins [BR:osa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   4334641
SSDB
Motif
Pfam: Phosphoesterase
Other DBs
NCBI-GeneID: 4334641
NCBI-ProteinID: XP_015631592
UniProt: Q94GF2 A3AP96
LinkDB
Position
3:34724325..34727279
AA seq 545 aa
MAGGGGRERRGGGRLLVGVLLLTLVVSGHCLESTHHRGLKRRRRKHEIHSPIKTVVVVVM
ENRSFDHILGWLSRTRPDIDGLNGTQSNRLNASDPSSPEIFVTDEAGYVDSDPGHGFEDI
REQIFGSADTSAVPAPMSGFAQNARGMGLGMPQNVMSGFKPESVPVYAALADEFAVFDRW
FASVPTSTQPNRLYVHSATSHGLTFNARKDLIHGFPQKTIFDSLEENGLSFGIYYQNIPA
TLFYQSLRRLKHLVKFHQYSLKFKLHAKWGKLPNYAVIEQRYFDCEMFPANDDHPSHDVA
RGQRFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTPVVGVPQPDGIVGPDPYYFK
FDRLGVRVPSFLISPWIEKRTVIHEPNGPQDSSQYEHSSIPATVKKLFNLHSNFLTKRDA
WAGTFENYFKIRKTPRTDCPEKLPEVTKSLQPFGPKEDSSLSEFQVELIQLASQLNGDHV
LNTYPDIGRTMTVGEANRYAEDAVARFLEAGRIALRAGANESALVTMRPALTSRASPSSD
LSSEL
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcgggcgggggaggtagggagcggcgcggcggggggaggctgctcgtcggggtgctg
ctcctgacgctggtggtgtccgggcactgcctggagagcacgcaccaccgcgggctgaag
cggcggcggcggaagcacgagatccactcgccgatcaagacggtggtggtggtggtgatg
gagaatcggagcttcgaccacatcctcgggtggctcagccgcacccgccccgacatcgac
gggctcaacggcacgcaatccaaccgcctcaacgcctccgacccttcctccccggagatc
ttcgtcaccgacgaggccggctacgtcgactccgaccccggccacggcttcgaggacatc
cgcgagcagatcttcggctccgccgacacctccgccgtgccggcccccatgtccggcttc
gcccagaacgcccgcgggatgggcctcggcatgccgcagaacgtcatgagcgggttcaag
ccggagtccgtgccggtctacgccgccctcgccgacgagttcgccgtgttcgaccggtgg
ttcgcctccgtgcccacctccacccagcccaatcgcctctacgtccattccgcgacctcc
catggcctcaccttcaatgcccgcaaggacctcatccatggcttcccgcagaagaccatc
ttcgatagcctcgaggagaacggcttgtcctttggcatctactaccagaacatcccggcc
acgctcttctaccagagcctccgccgcctcaagcacctcgtcaagttccaccagtacagc
ctcaagttcaagcttcacgccaagtggggaaagctgccgaattacgcggtgattgagcag
aggtacttcgattgcgagatgttccctgcaaacgatgaccacccctcgcacgacgtagcg
agggggcagaggttcgtcaaggaggtgtatgagacgctgcgagcgagtccgcagtggaac
gagactgctctgatcatcacctatgatgagcatggtggattctatgaccatgtgcctacg
ccggttgtcggggttccacagcctgatggaattgttggccctgatccttactacttcaag
tttgatcggcttggagtgcgcgtgccttctttccttatctcaccatggatcgagaagcgc
actgtgatccatgaaccaaatgggccgcaggactcctcacaatatgagcactcatccatc
cctgcaacagtaaagaagctatttaatttacattctaacttcctgacaaagagggatgca
tgggctgggacctttgagaactacttcaaaatccggaaaacacccagaactgattgtcca
gagaaactcccagaggtcacaaagtctctgcaaccgtttggccctaaggaagattcatct
ctgtcagagtttcaagtggagttgattcagcttgcttctcagctcaatggtgaccatgta
ctcaacacctacccagatattggcaggactatgactgtgggtgaagcaaaccgctatgca
gaggatgctgttgctagatttttggaagctggcaggattgctctaagagctggtgcaaat
gaatctgctttggtcaccatgaggcctgcactcaccagcagagcctcaccgtcctctgat
ttatcatctgaactctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334815
Entry
4334815           CDS       T01015                                 
Name
(RefSeq) non-specific phospholipase C4
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4334815
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4334815
   00565 Ether lipid metabolism
    4334815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:osa02042]
    4334815
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     4334815
Bacterial toxins [BR:osa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   4334815
SSDB
Motif
Pfam: Phosphoesterase Mononeg_mRNAcap
Other DBs
NCBI-GeneID: 4334815
NCBI-ProteinID: XP_015632215
UniProt: Q10AG8
LinkDB
Position
3:35906373..35908570
AA seq 527 aa
MAAAAAGGKIKTVVVLVMENRSFDHMLGWMKSLNPEIDGVTGDEINHLDAADPTSRAIRF
GDGAEYVDPDPGHSMQAIYEQVYGTPFVDARATPITPPGVPSPPMAGFAQQAEKEKPGMA
DTVMNGFRPEAVPVYRELVRQFAVCDRWFASNPASTQPNRLFVHSATSHGLVSNDTKLLV
AGLPQRTIFDSLHDAGFSFGIYYQYPPSTLFYRSLRQLKYAGNFHPFDLAFRRHCAEGKL
PNYVVVEQRYFDLKMLPGNDDHPSHDVSEGQRFVKEVYEALRGGPQWEEALLVVTYDEHG
GFYDHVPTPVDVPSPDGIVSAAPFFFEFNRLGVRVPALFISPWIEPGTVVHRPSGPYPTS
EFEHSSIPATVKKLFNLKSFLTNRDAWAGTFDVVLTRDAPRTDCPATLPEPVKMRPATEA
AEQAALTEFQEELVQLGAVLNGDHADEDVYPRKLVEGMTVAEAASYCNAAFKAWMDECDR
CRKCGEDGSHIPTVVKPPPPPSTSSSGSSSFASKLLSCFACGRPNKN
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggccggcggcaagatcaagacggtggtggtgctggtgatggagaac
cgctccttcgaccacatgctgggctggatgaagtctctcaacccggagatcgacggcgtc
accggcgacgagatcaaccacctcgacgccgccgacccgacctccagggccatccgcttc
ggcgacggcgccgagtacgtcgaccctgacccgggccactccatgcaggccatctacgag
caggtgtacggcacgccgttcgtcgacgcgcgcgccacgcccatcacccctcccggcgtc
ccctcgccgccgatggccggcttcgcgcagcaggcggagaaggagaagcccggcatggcg
gacaccgtcatgaacggcttccggccggaggccgtgccggtgtaccgcgagctggtgcgg
cagttcgccgtgtgcgaccgctggttcgcgtccaacccggcgtcgacgcagcccaaccgg
ctgttcgtccactcagcgacgtcgcacgggctcgtcagcaacgacaccaagctgctcgtc
gccggcctcccgcagcgcaccatctttgactccctccacgacgccggcttctccttcggc
atctactaccagtacccgccgtccacgctcttctaccggagcttgcgccagctcaagtac
gccggcaacttccaccccttcgacctcgcgttccggcggcactgcgccgagggcaagctc
cccaactacgtcgtcgtcgagcagcgctacttcgacctcaagatgctccccggcaacgac
gaccacccctcgcacgacgtctccgagggccagcgattcgtcaaggaggtgtacgaggcg
ctgcgtggcgggccgcagtgggaggaggcgctcctcgtcgtcacctacgacgagcacggc
ggcttctacgaccacgtcccgacgccggtggacgtgcccagccccgacggcatcgtcagc
gccgcgccattcttcttcgagttcaaccgcctcggcgtccgcgtcccggcgctcttcatc
tcgccgtggatcgagccgggcacggtggtgcaccggccgtcggggccgtacccgacgtcg
gagttcgagcactcctccatcccggccaccgtgaagaagctcttcaacctcaagagcttc
ctgaccaaccgcgacgcctgggcgggcaccttcgacgtcgtcctcacgcgcgacgcgccg
cgcaccgactgccccgccaccctgccggagccggtgaagatgaggccggcgacggaggcg
gcggagcaggcggcgctgacggagttccaggaggagctggtgcagctgggggcggtgctc
aacggcgaccacgccgacgaggacgtgtacccgcgcaagctggtggaggggatgacggtg
gcggaggcggccagctactgcaacgccgccttcaaggcatggatggacgagtgcgaccgc
tgcaggaagtgcggcgaggacgggtcccacatccccacggtggtgaagccgccgccgccg
ccgtcgacgtcgtcctcaggctctagctcctttgcttccaagttgctgtcttgctttgcg
tgtggtcgtcctaacaagaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350831
Entry
4350831           CDS       T01015                                 
Name
(RefSeq) non-specific phospholipase C4
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4350831
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4350831
   00565 Ether lipid metabolism
    4350831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:osa02042]
    4350831
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     4350831
Bacterial toxins [BR:osa02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   4350831
SSDB
Motif
Pfam: Phosphoesterase
Other DBs
NCBI-GeneID: 4350831
NCBI-ProteinID: XP_015615438
UniProt: A0A0P0Y3X8
LinkDB
Position
11:complement(22569980..22576811)
AA seq 535 aa
MAGKIKTVVVLVQENRSFDHMLGWMKSLNPEIDGVTGAEFNRATAGDPSSPAIHFGDGSG
YVDPDPGHSFQAIYEQVYGDAYTWGTTSPATKPGVPSPPMSGFAQEAEKERAGMSSTVMN
GFRPEKVPVYRELVREFAVCDRWFASVPTSTQPNRMFVHSATSHGLVSNDGKQLRAGLPQ
RTIFDALHDAGHSFGVYYQFPPSVLFYRNMRQLKYVGNFHPYDTAFKRDCKAGKLPNYVV
IEQRYFDLKLLPGNDDHPSHDVAHGQRLVKDVYEALRSSPQWHEILFVITYDEHGGFFDH
VPTPVAGVPSPDGIVSAAPVSFAFDRLGVRVPTLLVSPWIEPGTVVHDPASCGGAPEPTS
QFEHSSIPATVKRIFGLKEFLTRRDAWAGTFDTVLTRAAPREDCPATLPEPPRLRAAEAE
EHREVSEFQAELVQLGAALNGDHDGEGYDPEVFVRGMTVAGAAQYCRDAFDRFREECHRC
RDGGMDGSHVPMLQPASASASSSAPAADPPATAPAPATPSALSKLCGCFPCFNAS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcgggcaagatcaagacggtggtggtgctggtccaggagaaccgctccttcgaccac
atgctggggtggatgaagtcgttgaacccggagatcgacggcgtgacgggcgccgagttc
aaccgcgccaccgccggcgacccctcctccccggcgatccacttcggcgacggctccggg
tacgtggaccccgacccgggccactcgttccaggccatctacgagcaggtgtacggcgac
gcctacacgtgggggaccacctcgccggcgacgaagccgggggtgccctcgccgccgatg
agcgggttcgcgcaggaggcggagaaggagcgcgccggcatgtcgagcacggtgatgaac
gggttccggccggagaaggtgccggtgtaccgggagctggtgcgggagttcgccgtgtgc
gaccggtggttcgcgtcggtgccgacgtcgacgcagccgaaccggatgttcgtccactcg
gcgacgtcgcacggcctcgtcagcaacgacggcaagcagctccgcgccggcctgccgcag
cgcaccatcttcgacgccctccacgacgccggccactccttcggcgtctactaccagttc
cctccctccgtgctcttctacaggaacatgaggcaactcaagtacgtgggcaacttccac
ccctacgacaccgccttcaagcgcgactgcaaggccggcaagctcccaaactacgtcgtc
atcgagcagcgctacttcgacctcaagctcctcccgggcaacgacgaccacccttcccac
gacgtcgcccatggccagcgcctcgtcaaggacgtctacgaggcgctccgctcgagcccc
cagtggcacgagatcctcttcgtcatcacctacgacgagcacggcggcttcttcgaccac
gtccccaccccggtcgccggcgtcccttcccccgacggcatcgtcagcgccgcccccgtg
tcgttcgccttcgaccgcctcggcgtccgcgtcccgacgctgctcgtctcgccgtggatc
gagccgggcaccgtggtgcacgacccggcgtcgtgcggcggcgcgccggagccgacgtcg
cagttcgagcactcgtcgatcccggcgacggtgaagaggatatttgggttgaaggagttc
ctgacgaggcgcgacgcgtgggcgggcacgttcgacacggtgctgacgcgggcggcgccg
agggaggactgccccgccacgctgccggagccgccgcggctgcgggcggcggaggcggag
gagcaccgggaggtgtcggagttccaggccgagctggtgcagctcggcgccgcgctgaac
ggcgaccacgacggggaagggtacgaccccgaggtgttcgtccgcgggatgaccgtcgcc
ggcgccgcccagtactgccgcgacgcgttcgaccggttccgggaggagtgccaccggtgc
cgcgacggcggcatggacgggtcccacgtcccgatgctgcagccggcttcggcttctgct
tcgtcttccgctccggcggctgacccgccggccacggcgccggcaccggcgacgccgtcg
gctctgtccaagctgtgcggttgcttcccatgcttcaatgcgtcgtag

DBGET integrated database retrieval system