KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325413
Entry
4325413           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4325413
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4325413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4325413
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4325413
 Complex B
    4325413
SSDB
Motif
Pfam: RRM_1 PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 4325413
NCBI-ProteinID: XP_015632671
UniProt: A0A0N7KEF7 Q5JJU2
LinkDB
Position
1:42149716..42156839
AA seq 608 aa
MDPDQVEIPFKVLQERVPGKKKYSLRVIKPSSSKKICRSVNSYPLVCLKREMADNDHVHC
IMLTLNHRNILSMKALSRDKVESNGPSSLAAFVEPYTGLLSSLCFKHDCWGDRINHIPSP
LLQSLLRQVIEGLDFLRKNKLYHGNLNWDSILYLQPSTVKLANFRKQETMSLEEAQWADW
LCLIKMLEEILERAAEISSKLAQCDRYFCGHVESLTALLKTLDKTALPAIKEIVLGHPLF
WDLMTRVNFFAKDISLRLNDDTFMSRVRASKIRKLPWNEGTTQDFKGLLFEMETYRKDEG
IPAYDFRSLKDYVRCVCGAYAHWNKIKLNVDDIVRQNHPTICSDIWHLLGSSDMSHADSK
KPVEEIKLISDVVRDSPHKIFIAGIPRVISSKMLRDIVSSFGQLAAYRFLFNEDLGGACA
FLEYIDHSITSKACAGLNGMKLGGCVITAVGVLTDHPGQAGNEACPFHGIPANPKPLLAV
PTQVLQLKNVFDQEEYSLLSKYEVDAVLEDVRVKCARYGAVKSINVVEYPAGSDNTKAPA
VDARDNALASNNTALEAGCILVEFLCKEASFMAAHSLHGRPFGSRIVSAGYAPYDLLSLP
EVFPVLRF
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggacccagatcaagtggagattccctttaaagtgcttcaggagagagtccctggtaaa
aagaagtattccttaagggttatcaaaccttcgtcctcaaagaagatatgcagaagcgtt
aacagttatccccttgtctgtctgaagagggagatggcagataatgatcatgtgcattgc
ataatgcttacgctaaatcaccgaaacattctctcaatgaaagccctatccagggacaag
gttgagagcaatggcccctcatccttagcagcatttgtagagccttacactggactgtta
tcatcactttgttttaaacatgattgctggggtgacagaataaaccacattccttcacca
ttactccagtccttattaaggcaagtcattgaggggcttgacttcttgaggaagaacaaa
ctgtatcatggtaatctcaattgggattcgattttgtatcttcaaccgtctaccgttaag
cttgctaacttcagaaaacaagagacaatgagcttggaggaagcccagtgggccgattgg
ttgtgccttattaaaatgcttgaagaaattttagaaagagctgctgaaataagctcaaag
cttgctcaatgtgatagatatttctgcggacatgttgaatctttgactgctctattgaaa
accctggataagactgcattgccggcaattaaagaaattgttcttgggcatcctcttttt
tgggatttgatgacgagggtaaacttctttgcaaaggatatatcacttaggttgaatgat
gacacttttatgtcaagagtgagagcttcaaaaatccgtaagcttccttggaatgaagga
acaactcaagactttaaaggtctcctgtttgaaatggaaacctatcgtaaagatgaagga
attccagcatatgacttcagaagcttaaaagattatgtacgctgtgtctgtggtgcttat
gctcactggaataaaataaagctaaatgttgacgacattgttcggcaaaaccatcctacc
atatgcagtgatatctggcatcttcttggaagttcagacatgtcgcatgctgattctaag
aagccagttgaagagattaaattaatatctgatgtcgttagagattcaccacacaagatt
ttcatcgctggaattcctagagtgatttcatctaagatgctcagggatatagttagttca
tttggtcaattggctgcttaccgctttctttttaatgaagaccttggtggagcatgcgca
tttcttgagtacattgatcactccattacatcaaaggcatgtgctggccttaacggcatg
aagcttggtggatgcgtaataactgctgttggcgtgttaactgatcatcctgggcaggct
ggcaatgaagcttgcccatttcatggaattcctgccaatcccaaacctcttcttgcagta
ccaacacaagtcctgcagctaaaaaatgtgtttgaccaggaggaatactcgctgctttca
aaatatgaggtagatgcagtattggaagatgtacgtgtgaagtgtgcaaggtatggagct
gtgaaatccataaatgtcgtagagtatcctgctggcagtgacaacaccaaggcacctgca
gtagatgctagagacaacgctttggcttctaacaacactgcactcgaagctggctgtata
cttgtagagttcttgtgcaaggaggcttcattcatggctgctcattcactccatggccgg
ccttttggcagcaggattgtctctgcgggatatgctccatatgatctcttatctctaccg
gaggtatttccagtgttgagattctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331556
Entry
4331556           CDS       T01015                                 
Name
(RefSeq) splicing factor U2af large subunit B-like isoform X1
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4331556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4331556
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4331556
 Complex B
    4331556
SSDB
Motif
Pfam: RRM_1 RRM_9
Other DBs
NCBI-GeneID: 4331556
NCBI-ProteinID: XP_015630379
UniProt: Q10S20
LinkDB
Position
3:complement(2103208..2112179)
AA seq 964 aa
MSRRVQNEKDSRRITSDGTAARTRPLSIQDIMSRREKKTASEAKKTKEGLEENSNGKSNH
LESGRGSKSRKDVREMPLEGSKKDNSDKPGEGSKKDEMRHTPREERRKDNMRDMQREVSK
KDNLKDRPKDISKIDNLKVKVKVPSKDDQRDAPKKSSKKERSSTRDDSHLVDKDKGNHNS
HKLSTYTSGRVGKSRGGNHGEITARDGDATIQESQKRPGKRWIDEPVGNDRIKERSERRT
DGKRNSRGFDDEKSSQVDRPTLKKQDAVRLQDPRHFDRKDGRKENAKLHHEEPRSKRRRS
TSRDHYQERHDRSVSPSSREQRHSYRGHGHDYYPPYHSMDKSRRKHFETDRHRTSWNDGY
SSGSYRRYESRLGGYSPRKRKTAPKDEQTTIKTASLVIRSPEKKSATWDQLPVATDLSNF
VTTLQSTVGLKDSTVPVNFTTSKQDPNTTIGTILTGSNLAVDSVQLTQATRPLRRLHIEN
LPSLATEDMLIGCLNEFLLSSSASHIQRSKQPCLSCVINKDKRQAFVEFLTPEDATAALS
FDGRSFGGSSLKIRRPKEYVEMAHVAPKKPSEEIKLISDVVADSPHKIFIAGISGVISSE
MLMEIVSSFGPLAAYRFLFNEYLGGACAFLEYIDHSITSKACAGLNGMKLGGGILTAVNV
FPNSTEQAFNEASPFYGIPDSAKSLLEEPTKVLQLKNVFDQEEYLLLSKSELEEILEDVR
VECARFGAVKSINVVKYPASSDNTTGDTITECEDGSTKIEPKEYGGNVSCTETGVECSVL
NQSTDVPDPSICEVQDPVELDTDSIPKGRDHKNLDTRGECDAPTAGDENTDQGVEADQTD
STDAQDDARGTIERGHADADPASLETSCSTAPGDGADKSGRENEQQGGAGVSESNTEKAP
AVDARDNALASNTSALEAGCILVEFLRKEAACIAAHSLHGRRFGSRIVSAGYAPHDLYLQ
KYPR
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgagtagaagagtacagaacgaaaaggattctaggagaatcactagtgatgggacggct
gctcgcacaaggcctttgagcattcaggatatcatgtcgcgtcgtgaaaagaaaaccgct
tcagaagctaagaaaaccaaggaagggctcgaagagaacagtaatggtaaatccaatcat
ctggaatcaggaagagggtccaaaagcagaaaggatgtcagagaaatgcccttggagggc
tccaaaaaggataatagtgataaaccaggggagggttccaagaaggatgaaatgagacat
acgccaagggaagagcgtagaaaggacaacatgagagatatgcaaagagaggtctccaag
aaagacaacctgaaagataggccaaaagacatctccaagatagataacttgaaagttaaa
gtgaaggtcccatcgaaagatgatcaaagagatgcaccaaagaagagctccaagaaagag
cggtcctccacaagagatgatagtcatttagttgacaaagacaaaggcaatcataattct
cataagcttagcacatacacgagtggtcgagttggcaaaagcagaggtggaaaccatggt
gagattacagcaagagacggtgatgcaacaatacaggaatcccaaaaaagacctgggaaa
agatggattgatgaaccagttggtaatgatagaatcaaggagaggagtgagaggcgaact
gatggaaagagaaatagccgtggctttgatgatgagaagagttctcaggttgatcgaccc
acactgaagaaacaagatgctgtgcgattacaagatcccagacattttgatagaaaagac
gggaggaaagagaatgcaaaactgcaccatgaagagcccaggtcaaaaaggagaaggtcg
acaagcagggatcattatcaagaaagacatgacaggtctgtctcaccatcctcaagagaa
caaaggcatagctatcgtggacatggccatgattattatcctccatatcactccatggac
aaatcaagaaggaagcattttgaaactgacagacatagaacatcttggaatgatggatac
agtagtggatcttaccggagatatgaaagtcggcttggtggatattcaccaaggaaaagg
aaaacagcaccaaaagatgaacagacaactatcaagactgcttctctggttattcggtct
ccagaaaagaaatcagccacatgggatcagcttcctgtggcaacagatctatctaatttt
gttaccactttgcagtcaacggttggtctaaaggattccactgttccagtcaattttacc
acatcgaagcaggacccaaacactacaattggaactatattgacagggagtaatttggct
gttgattctgtccagctgacacaagcaacccgaccactcaggagattgcacattgaaaat
ctaccaagtttagccacagaagacatgctgattggctgcttgaatgagttcttgctgtca
tctagtgcgagccatatccagaggtccaaacaaccatgcctcagttgtgtgataaacaag
gacaaacgtcaggcctttgttgaatttcttacaccagaggatgctacagcagctctttct
tttgacggacggtcttttggtggatcttctttgaaaattagacgccccaaagaatatgtt
gaaatggcacatgttgctcctaagaagccttctgaagagattaaattgatatccgatgtt
gttgcagattcaccacacaagattttcatcgctgggatttctggagtgatttcatctgag
atgctcatggaaattgttagttcatttggtccgttggctgcttaccgctttctttttaat
gaataccttggtggggcatgtgcatttcttgagtacattgatcactccattacatcgaag
gcatgtgctggcctcaatgggatgaagcttggtggaggcatcctaactgctgttaatgtg
ttccctaactctaccgagcaggcttttaatgaagcttccccattttatggaattcctgac
agtgccaaatcactacttgaagaaccaacaaaagtcctgcagctaaaaaatgtgtttgac
caagaagagtatttgctactctcaaaatctgagctggaggaaatattggaagatgtacgt
gtggagtgtgcaaggtttggagctgtgaaatccataaatgtcgtaaagtaccctgctagc
agtgacaacactacaggggataccataaccgagtgtgaagatggatccaccaagattgag
cccaaagaatatggtggcaatgtcagctgcactgagactggagtggaatgttctgtgttg
aatcagagtacagatgttcctgatccttctatttgtgaggtccaggatcccgtagagctt
gacacagattctattcccaagggtcgggaccacaaaaatcttgacacacgtggcgagtgt
gatgcacctacagcaggagacgagaatactgatcaaggagtggaagctgatcagacagat
tctacggatgctcaagatgatgctcgtggaactatagagagagggcatgcagatgcagat
ccggcgtccttggaaacttcttgttccacagcacctggagatggagcggacaaatctggt
agggagaacgagcaacaaggtggtgctggtgtgagtgaaagcaacacagagaaggcacct
gcagttgatgctagagacaacgctttggcttcaaacaccagtgcgctcgaagctggctgt
atacttgtagagttcttgcgcaaagaggctgcatgcattgcagctcattcactacatgga
cggcgttttggcagcaggattgtctctgcaggatatgctccacatgatctttacttacag
aagtatccgaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339621
Entry
4339621           CDS       T01015                                 
Name
(RefSeq) splicing factor U2af small subunit B
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4339621
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4339621
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4339621
 Complex B
    4339621
SSDB
Motif
Pfam: zf-CCCH RRM_1 Torus zf_CCCH_4 zf-CCCH_4 Autophagy_act_C Keratin_2_head
Other DBs
NCBI-GeneID: 4339621
NCBI-ProteinID: XP_015639721
UniProt: Q6AUG0
LinkDB
Position
5:28080128..28082850
AA seq 304 aa
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTVSPTIVLANMYQRPDMITP
GVDAQGQPIDPEKMQEHFEDFYEDIYEELSKFGEVETLNVCDNLADHMIGNVYVQFREEE
QAVAAHNALQGRFYSGRPIIVEYSPVTDFREATCRQFEENSCNRGGYCNFMHVKQIGREL
RRKLYGGRSRRSHGRSRSPSPRHRRGNRDRDDFRRERDGYRGGGDGYRGGGGGGGGDGYR
GGDSYRGGGGGGRRGGGSRYDRYDDGGRRRHGSPPRRARSPVRESSEERRAKIEQWNRER
EEKP
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcggagcatttggcttcaatatttgggactgagaaggatagggttaactgccccttt
tacttcaagattggggcttgccgtcatggggatcgttgctcccgtctgcacaacaggcca
actgtgtcgccgacaattgtgcttgctaacatgtatcagcgccctgatatgatcacacca
ggagtcgatgctcaaggccaacctattgatcctgaaaagatgcaggagcactttgaggat
ttctatgaggatatctatgaggagctgagcaagtttggtgaggttgagaccctcaatgtc
tgtgataaccttgctgaccacatgataggcaatgtgtatgtccagttcagggaggaagaa
caggcagtcgctgcgcataatgcccttcaaggtcgcttctactcagggcgcccaataatt
gttgagtattcccctgtgactgatttccgtgaggcgacctgtaggcagtttgaggagaac
agctgcaaccgtgggggctactgtaattttatgcatgtaaagcagattggcagggagctc
aggaggaagctttatggggggcgatccaggaggagccatgggagaagccgcagcccaagc
ccacgccacaggaggggcaatcgtgaccgtgatgatttccgccgtgaacgtgatggttat
cgtggtggtggtgatggttaccgtggcggcggcggtggcggtggtggtgacggttaccgc
ggcggtgatagttaccgtggtggtggtggtggtggacgcaggggtgggggcagcaggtat
gacaggtatgatgatggaggaaggcgcaggcatggcagccccccaaggcgtgcaaggagc
ccagtcagggaaagcagcgaggaacgcagggcgaagattgaacagtggaaccgtgaacgg
gaggaaaagccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350981
Entry
4350981           CDS       T01015                                 
Name
(RefSeq) splicing factor U2af large subunit A
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4350981
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4350981
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4350981
 Complex B
    4350981
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_occluded BUD22
Other DBs
NCBI-GeneID: 4350981
NCBI-ProteinID: XP_015617576
UniProt: Q2R0Q1
LinkDB
Position
11:complement(25148712..25153445)
AA seq 574 aa
MAEHEEQPYEGNGNGGDPAPASAYAEYPAPEGSPPAAAAKPTGFSDGATDGGRSQHETQP
HDGRSSKSRERERERDKDKERDRDRDRDRRDRDRGDKDRDRDRHREHRDRSERREHHDRE
RSDDRDRRRGHDSERRRDRDRDGHRRHRSRSRSPSKGRDRRSRSRSRSRSSKRVSGFDQG
PQAAIPALAAGAAPGQVPVVAPAISGMLPNMFNLTQTPFTPLVIQPQAMTQQATRHARRV
YVGGLPPTANEHTVAVYFNQVMAAVGGNTAGPGDAVLNVYINHDKKFAFVEMRSVEEASN
AMALDGIMFEGAPVKVRRPTDYNPSLAAALGPSQPNPNLNLAAVGLTPGSAGGLEGPDRI
FVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALN
GIKMGDKTLTVRRANQGASQPRPEQESMLLHVQQQAQMQKLMFQVGGGALPTKVVCLTQV
VSPDELRDDEEYEDIVQDMREEGCRYGNLVKVVIPRPDPSGAPVAGVGRVFLEFADVESS
TKAKNGMHGRKFANNQVVAVFYPEDKFAEGQYDG
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcggagcacgaggagcagccctacgagggcaacgggaacggcggcgacccggccccc
gcctccgcgtacgctgagtaccctgcgcccgaggggtccccgcccgccgccgccgccaag
cccaccggcttctccgatggcgccaccgacggcggccgttctcagcacgagacacagcca
catgatggcaggtcctcaaagtctagagagagggaaagagaacgggacaaggacaaggaa
cgcgacagagaccgtgatagagaccgaagggaccgcgaccgtggtgacaaggacagggac
cgtgatcgccacagggagcaccgcgatagaagcgaaagaagggaacaccacgatcgtgaa
cgttctgatgaccgtgatcgacgccggggccatgattctgaaaggagaagagaccgtgac
agagatggtcaccgcaggcatcgatctcgctcccgctccccttcaaagggtcgtgatcgc
agatctagatctcgctcacgctctcgatctagcaagcgcgtgagtggatttgaccaggga
ccacaagcagccattcctgcgcttgctgctggagcagccccaggtcaggtacctgttgtg
gcccctgctatttctgggatgcttccgaacatgttcaatttgactcaaaccccgttcact
ccgcttgttattcagccacaagctatgacacaacaggctactcgacatgctaggcgtgtt
tatgttggtggacttcctccaactgctaatgagcatactgttgctgtatacttcaatcaa
gttatggctgctgttggtggaaatacagctggtccaggtgatgctgttcttaatgtctac
ataaaccatgataagaaatttgcatttgtggagatgaggtctgtggaggaagcaagcaat
gcaatggccttggatggtataatgtttgagggagcacctgtgaaggttagaaggccaaca
gactataatccttccctagcagctgcattgggtccaagccagccaaaccccaacctcaat
cttgctgctgttggcttaacacctggctcagctggaggtttagaaggtcctgaccgcatt
tttgtgggtgggctgccctattacttcacagaagctcaagtcagggagttgctcgaatcc
tttggacctctgcgtggttttgatcttgtgaaggacagagaaactggaaactcgaagggc
tatgctttctgtgtataccaggatcttaatgtcacggacattgcctgtgctgctcttaat
ggtatcaagatgggagacaagaccctcactgttaggcgagctaaccaaggagcttctcaa
cctaggccagagcaagaaagcatgctcctgcatgtacaacaacaggcgcaaatgcagaaa
ctcatgttccaagttggagggggagcactgcctacaaaggtggtatgcctgacccaagtg
gtttcaccagatgaactgagggatgatgaggagtatgaggacatcgtgcaagacatgagg
gaagaagggtgcagatacggtaacctggtgaaagttgtgatcccgcgacctgatcccagc
ggtgctcctgttgctggagttgggagggtgtttttggaatttgcagatgtagagagctcg
accaaggcgaagaatgggatgcacgggaggaagtttgccaacaaccaggtggtggctgtc
ttctaccctgaggacaagttcgctgaagggcaatacgacggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351124
Entry
4351124           CDS       T01015                                 
Name
(RefSeq) splicing factor U2af large subunit B isoform X2
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4351124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4351124
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4351124
 Complex B
    4351124
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_occluded DUF4154 Presenilin
Other DBs
NCBI-GeneID: 4351124
NCBI-ProteinID: XP_015617533
UniProt: Q2QZL4 B9G8T5
LinkDB
Position
11:27590932..27596211
AA seq 548 aa
MADDHAAAADLVDGGRPEGDTHSREDGLSKPRDKDREREKDKDRERHRDRDRDRGRDRDR
DKDKEKDRDKERDRDRDRDKDRDRHHRHHRERREHRDRSDDHDRHRSRDSERRRDHERDG
RRRHRSRSRSRSRGRDRRSRSRSRSKSKRVSGFDMAPPAQAVVPQFPAIPTPSQFPGTAI
PGMFPNMLPMGVGQFNPLVIQPQAMTQQATRHARRVYVGGLPPTANEQSVAIYFNQVMAA
IGGNTAGPGDAVLNVYINHDKKFAFVEMRSVEEASNAMALDGILFEGAPVKVRRPTDYNP
SLAAALGPSQPSPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQVRELLESFGPL
RGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALNGIKMGDKTLTVRRANQGAAQPRPE
QESILLQAQQQVQLQKLVYQVGALPTKVVCLTQVVSADELKDDEEYEDIMEDMRLEAGKY
GNLIKVVIPRPDPSGLPVAGVGKVFLEYADVDGATKAKTAMHGRKFGGNPVVAVFYPENK
FSSAEYDA
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcggacgaccacgccgccgccgccgacctcgtcgacggcggacgccccgagggcgat
acgcattcacgtgaagacggattatcaaaaccaagagataaagatagagaaagagaaaaa
gacaaggacagggaacgccacagggaccgtgacagagatcgaggaagagaccgagatcgg
gacaaggacaaggaaaaagacagagacaaagaaagggacagggatagggacagggacaag
gatcgggatcgccaccataggcatcaccgtgaaagaagagaacacagagatcgctctgat
gatcatgatcgccacagaagccgtgattctgaaaggagaagagaccatgaacgggatggg
cgtcgcaggcatcggtctcgctcacgctctcgttctaggggcagggatcgcagatctagg
tctcgctctcgttcaaaaagcaagcgagttagtggatttgatatggcgcctccagctcaa
gctgtggttccacaatttcctgctattccaaccccaagtcagtttccgggcactgctatt
cctggaatgtttccaaacatgctcccgatgggtgttggacagttcaatccccttgttatc
cagccgcaagcaatgacgcaacaggctactcgacacgcgagacgtgtttatgttggtgga
cttcctccaactgctaatgaacagtcagttgcaatatactttaatcaagtcatggctgct
attggaggaaatactgctggtccaggtgacgctgttcttaatgtctacataaaccatgac
aagaaatttgcttttgtggaaatgaggtctgtggaggaagcaagcaatgcaatggcactg
gatggcattttgtttgaaggggctccagtgaaggttaggagaccaacagactataaccct
tctctggcagctgccttgggccccagccagccaagccccaatctgaatcttgctgcagtt
ggcttaacacctggttcagctggagggctagaaggcccagatcgtattttcgtgggtggc
cttccatattacttcactgaggctcaagtccgggagttgcttgaatcctttgggcctctt
cgaggatttgaccttgtgaaggatagggaaactggtaactcaaagggctatgcattctgt
gtctaccaagatctcaatgtcactgacatagcctgtgctgctctgaatggcatcaagatg
ggagacaaaaccctaactgttagaagggcaaaccagggagcggctcagcctagaccagaa
caggaaagtatcctgttgcaggcacagcaacaagtgcaattacagaaacttgtatatcaa
gttggagcactccctacaaaggttgtgtgcctgacccaggtggtttcggctgatgaatta
aaagatgacgaggagtatgaagacattatggaggacatgagattggaagcaggcaaatat
ggtaatctgattaaggttgtcatccctcgccctgatcctagtggattaccagttgctgga
gttggaaaggttttcttggagtatgcagatgtggacggcgccaccaaagcaaagacggca
atgcatggaaggaagttcggtggaaatccagttgttgcagtgttctaccctgagaacaag
ttttctagtgcggaatatgacgcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268567
Entry
9268567           CDS       T01015                                 
Name
(RefSeq) splicing factor U2af small subunit A
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9268567
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9268567
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    9268567
 Complex B
    9268567
SSDB
Motif
Pfam: zf-CCCH RRM_1 zf_CCCH_4 Torus zf-CCCH_4
Other DBs
NCBI-GeneID: 9268567
NCBI-ProteinID: XP_015611784
UniProt: Q9ZQW8
LinkDB
Position
9:18985428..18987197
AA seq 290 aa
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNKPSVSPTLLLSNMYLRPDMITP
GIDAQGNPIDPEKIQADFEDFYEDIFEELSKYGEIESLHVCDNFADHMIGNVYVQFREED
QAARALQALTGRYYSGRPIIVEFSPVSDFREATCRQYEENSCNRGGYCNFMHVKEIGRDL
RKRLFGHLHRSRRSHSHGRSRSPSPYHYRRDYDRRSSSRSRDHDDYYRGGSHDYYRGGSR
RSSERHRSSYDSDGSRRRHRSRTRSPVRDGSEERRAQIEQWNREREAAQV
NT seq 873 nt   +upstreamnt  +downstreamnt
atggccgagcacctcgcttccatctttggcacggagaaggaccgcgtgaactgccccttc
tacttcaagatcggcgcgtgccgccatggcgaccgatgctcccgcctgcacaacaagccg
tcggtctcgccgacgctgctgctctccaacatgtacctgcgtccggacatgatcacccct
ggaattgatgctcagggcaaccccatcgaccctgagaagatccaggccgacttcgaggat
ttctacgaggacatctttgaggaactcagcaagtacggcgagatcgagagcctccacgtg
tgtgacaacttcgccgaccacatgatcggcaatgtgtatgttcaattcagggaggaggat
caggccgccagagcgctgcaggcgctgacggggcggtactactccggccgtcctatcatt
gtcgagttctcgccggtgtccgatttccgggaggccacctgccggcaatatgaagagaac
agctgcaaccgtggtgggtactgcaacttcatgcacgtcaaggagatcggcagagacctg
aggaagaggttgtttgggcacctgcataggtcccggagaagccatagccatggccggagc
cgcagcccgagcccgtaccattaccggagggactatgatcggaggagctcatcgcggtcc
agggaccacgacgattactaccgtggaggtagccacgattactaccgtggaggtagccgg
aggagcagcgagaggcaccgcagcagctacgacagcgatggcagcaggcggcggcacagg
tccaggactaggagtcctgtcagggatggtagcgaggagaggagagctcaaattgagcag
tggaaccgtgaaagggaggctgcacaagtgtga

DBGET integrated database retrieval system