KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325448
Entry
4325448           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphatase 1
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4325448
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     4325448
SSDB
Motif
Pfam: S6PP S6PP_C Hydrolase_3
Other DBs
NCBI-GeneID: 4325448
NCBI-ProteinID: XP_015620880
UniProt: Q94E75
LinkDB
Position
1:complement(15568776..15573393)
AA seq 423 aa
MDKLSGSARLIIVSDLDHTMVDHHDEENLSLLRFGALWESVYCQDSLLVFSTGRSPTLYK
ELRKEKPMLTPDITIMSVGTEITYGEAMVPDDGWEEYLNNKWDRNVVVEETAKFSELKLQ
PETEQRPHKVSFFVDKKSAQEVIKSLSGNMEKCGLDVKIIYSGGQDLDILPQGAGKGQAL
AYLLKKLSSCGKPPNNTLVCGDSGNDAELFSIPGVHGVMVSNAQEELLQWYAENAKGNPK
IIHATERCAAGIIEAIGHFKLGPSVSPRDVGFPYVKEDHIKPTDAVVKFYVLYEKWRRAE
VPKSDSVVQYFKNITHANGVIIQPSGLECSLHASVDALSSCYGEKQGKKYRTWVDRLFVS
QSGSDSWLVRFDLWEAEGDARLCCLTSLALNVKPETPAGFLITHVHKTWLKGYSSADEQS
SKL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggataagctcagtggttctgcacgtcttattatcgtttcagatcttgaccacacgatg
gttgatcatcacgatgaggagaacttatccttgcttagatttggcgccctgtgggagtcc
gtttactgtcaggattctctactagtattttcaactggaagatcccctactctttataag
gaattgaggaaagagaagcctatgctaactccagacatcactatcatgtctgtggggact
gagataacatatggtgaggcaatggttcctgatgatggttgggaggaatatctgaacaat
aagtgggacaggaatgtagttgtggaggagacagctaagttttctgagctgaagcttcag
ccagagacagaacagcgtccacataaggtcagcttttttgttgataaaaagagtgctcag
gaagtgataaagtctctctccggtaatatggagaaatgcgggcttgatgttaaaataatc
tacagtggtggccaagaccttgacatattacctcagggcgctgggaagggtcaagcactt
gcatatttgcttaagaagttaagctcctgtggaaaaccaccaaacaatactcttgtttgt
ggggactctggtaatgatgcagaattatttagcatccctggtgtacatggtgtcatggtt
agcaatgcccaagaggaattgcttcagtggtatgcagaaaatgcgaagggtaaccctaaa
attattcatgcaactgagaggtgcgccgctggtattatcgaagctattggacacttcaaa
ctaggacctagtgtttctccaagagatgtggggtttccttatgttaaggaggaccatatc
aaacctacagatgctgttgtaaagttttacgttctctatgagaagtggcgcagggctgag
gttccaaaatcagattcagttgtacagtacttcaaaaatatcactcatgcaaatggtgtt
atcattcaaccttctgggcttgaatgttctctccatgcctctgttgatgcattgagttca
tgttatggtgagaaacaagggaaaaaataccgaacatgggtggacagactatttgtctca
cagtctggttcagacagttggctggtcagatttgacttgtgggaggcagaaggtgatgcg
cggttgtgctgtttgacaagtcttgcgctgaatgtaaagcctgaaacccctgctggcttc
ctgataacacatgtacacaaaacatggctcaaaggatactcttcagcggatgagcagtcc
tccaagctttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328274
Entry
4328274           CDS       T01015                                 
Name
(RefSeq) sucrose-phosphatase 2
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4328274
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     4328274
SSDB
Motif
Pfam: S6PP S6PP_C Hydrolase_3 PMM Trehalose_PPase PG_binding_4
Other DBs
NCBI-GeneID: 4328274
NCBI-ProteinID: XP_015622612
UniProt: Q6YXW6
LinkDB
Position
2:2388405..2394346
AA seq 423 aa
MDKLNGSARLMIVSDLDHTMVDHHDEENLSLLRFGALWESVYCQDSLLVFSTGRSPTLYM
ELRKEKPMLTPDITIMSVGTEITYGEEMVPDDGWVEYLNNKWDRNIVVEETANVSELKLQ
VESEQRPHKVSFYVDKKSAQEVIKSLSEKLEKRGLDVKIIYSGGQDLDVLPQGAGKGQAL
AYLLKKLSSCGKPPNNTLACGDSGNDAELFSIPGVHGVMVSNAQEELLQWYSENAKDNPK
IIHATERCAAGIIQAIGHFKLGPNVSPRDVDFPYVKENPVKPTDAVVKFYVLYEKWRRAE
VPKSDSVTQYFKNITHANGVIIHPAGLECSLHASIDALGSCYGDKQGKKYRAWVDRLVVS
QCGSEGWLVRFNLWELEGDVWSCCLTSLALNAKPETPEGFVVTHIHKTWLKGYSSADEQS
SKL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggataagctcaatggttctgcgcgtctcatgattgtttcagatcttgaccatacaatg
gttgatcatcatgacgaggagaacctgtcattgcttagatttggtgccctgtgggagtct
gtttactgccaggattctttacttgtattttcgactggaagatcacctaccctgtatatg
gaattgaggaaagagaaacctatgctaactccagacatcactatcatgtctgtgggcact
gagataacatatggtgaggaaatggttcctgatgatggctgggtggaatatctgaataat
aagtgggacaggaatattgttgttgaggagacagcaaatgtttccgagctgaaacttcag
gtagagtcggaacagcgtccacataaggtcagcttctatgttgacaaaaagagtgctcag
gaagtgataaagtctctctctgagaagttggagaaacgtgggctagatgttaaaataatc
tatagcggtggccaggaccttgatgtattacctcaaggtgctggaaagggtcaggcactt
gcatatttgctcaagaagttaagctcatgtggaaaaccacccaataatactcttgcttgc
ggtgactctggcaacgatgcagaattattcagcatccctggtgtacatggtgtcatggtc
agcaatgcccaagaggaactacttcagtggtattcagaaaatgcgaaggataatcctaag
ataattcatgcaactgagaggtgtgctgctggaatcatacaagccattggacacttcaaa
ctaggacctaatgtttctccccgagacgtggatttcccttatgtcaaggagaacccggta
aagcctacggatgctgttgtaaagttttatgttctctacgagaagtggcgtagggctgag
gttccaaagtctgattcggttacacagtatttcaaaaatataactcatgcaaatggagtt
attattcatcctgctgggcttgagtgttctcttcatgcatcaattgatgcattggggtca
tgttacggtgacaaacaagggaagaaatacagagcatgggtggacagactggttgtctca
caatgtggttcagagggttggctggtgagatttaacttgtgggagttggaaggtgatgtg
tggtcgtgttgtctgacaagtcttgcactgaatgcgaagcctgaaacccccgagggcttc
gtggtaacacacatccacaaaacatggctcaaagggtactcatcagcggatgagcaatcg
tccaagctttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337789
Entry
4337789           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphatase 3
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4337789
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     4337789
SSDB
Motif
Pfam: S6PP S6PP_C Hydrolase_3 Trehalose_PPase
Other DBs
NCBI-GeneID: 4337789
NCBI-ProteinID: XP_015640393
UniProt: B9FME4
LinkDB
Position
5:2594772..2598457
AA seq 423 aa
MDKLDGSARLMIVSDLDQTMIDHNDPKNLSLLRFQALWESEFSQDSLLVFSTGRSPISYR
GLRTQKPLITPDITIMSVGTVIAYGEEMIHDVGWAEFLSNKWDRDIVVEETAKFPKLKPQ
PERSQGPHKVSFFVDKEGAREVMDSLPETLNRRGLDVKIIFSSGEALDVLPQGAGKGQAL
LYLLKKFNSDGKPPNSTLVCGDSGNDAELFSVPSVHGVMVSNAQEELLQWYEENARGNPM
MIHATERCAAGIMQAIGHFNLGPNVSPRDLEFPYPKLDAIKPADVVVKFYVLYEKWRQGE
VQKAPFIIQYLKRITHPNGTTIHPSGRECSLHASIDALSSCYADKQGKKFRVWVDRIVAS
SIGTINWLVRFDKWEMEGNVRYCCLTTLLLTMKPETEDGFEITHIHKTWLEGYSAGNEHA
CIL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggataagctcgatggctctgcccgtcttatgatagtttccgatcttgaccagacaatg
attgatcacaatgatccgaagaacttgtccttgcttaggttccaggcgctatgggagtcc
gagttctcccaagattctctactggtcttctcgactggaagatcacctatcagttacagg
ggtttgagaacacagaagcctttgatcactccagacatcactatcatgtctgtgggcact
gtgatagcatatggtgaagagatgattcatgatgttggctgggctgaattccttagcaac
aaatgggatagggatatcgttgtcgaggagacagctaagttccctaagctgaagcctcag
ccagagaggagtcagggtcctcataaggttagcttttttgtcgacaaggagggtgctcgg
gaagttatggattctctccctgagacgttaaatcggcgtgggctagatgttaaaataatc
ttcagtagtggtgaggcccttgatgtattaccacaaggtgcaggaaaaggccaggctctt
ctatatttgctgaaaaagttcaattcagatgggaaaccaccaaacagtactcttgtttgt
ggtgactctggcaatgatgcagaattattcagtgtcccatctgttcatggtgtcatggtc
agcaatgcccaagaggagctgcttcagtggtatgaagaaaatgccaggggcaatcctatg
atgattcatgcaaccgagaggtgtgctgctggcatcatgcaagctattggacacttcaat
ttaggacctaacgtttccccaagagatcttgaattcccttacccgaagttagacgccatc
aaacctgcagatgttgtggtgaagttttatgttctctatgaaaaatggcggcagggtgag
gttcaaaaggccccattcattatccagtatttgaaaaggattactcatcctaatggaaca
actattcatccttctggaagggagtgttcacttcatgcatccattgatgcactgagttca
tgttatgctgataaacaaggcaagaagttccgagtatgggtggatagaattgtcgcttca
tcaatcggtacaattaattggctggtgaggtttgacaagtgggaaatggaaggcaatgtt
cggtattgctgcctcacaactcttctgctgactatgaagcctgagactgaagatggcttc
gagattacacacatccacaagacctggcttgaaggatactctgcaggaaatgagcatgca
tgcatcctgtag

DBGET integrated database retrieval system