KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325469
Entry
4325469           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4325469
  KO
K12593  M-phase phosphoprotein 6, animal type
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325469
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325469
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     4325469
SSDB
Motif
Pfam: MPP6 EB1_binding
Other DBs
NCBI-GeneID: 4325469
NCBI-ProteinID: XP_015623824
UniProt: A0A0P0UY15 Q5ZBL4
LinkDB
Position
1:2403256..2405981
AA seq 200 aa
MAAKRELSSTLRNLKFMQRAAVAQKVEEKPKVEAAAAAAEEEVVTVPSGGVGSSVKVARK
CVVIMEGNPHPGAAKGRMSFLNFNPSIDKLTQEATGGRQSQLASPSNNHQDGSNSSRTDE
VSRTRFSDFNIDSSESISLNELKRKQPELEMETPPSHRQPKTTGKSIDGDSSSQSNGRGS
HKSNKREKLDWNLLRPRKSK
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcggcgaagcgggagctctcgagcaccctcaggaacctcaagtttatgcagcgggcg
gctgttgcgcagaaggttgaggagaagcccaaggttgaggcggcggcggcggcggcggag
gaggaggtggtgacggtgcctagcggaggtgttggctcgtcggttaaagtcgctcggaag
tgcgtagttatcatggagggtaatccacaccctggagctgcaaagggtcgaatgtcattc
ctgaatttcaacccatccattgataaattaactcaagaggcaacgggtggccgccaatca
cagttagcatcacctagtaataatcatcaggatggttcgaattccagcagaacggatgaa
gtatcaagaacaagatttagtgacttcaacattgatagttcagaaagcatatctctgaat
gaactaaagaggaaacagcctgagcttgaaatggaaacaccaccatcacataggcagccc
aagaccacaggtaagagtatcgatggtgattcatcttcccaaagcaatggccgtgggtct
cacaagtcaaacaagcgtgaaaagcttgactggaatcttcttagaccacggaaatcaaaa
tga

DBGET integrated database retrieval system