KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325474
Entry
4325474           CDS       T01015                                 
Name
(RefSeq) putative lipid phosphate phosphatase 3, chloroplastic isoform X1
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4325474
   00564 Glycerophospholipid metabolism
    4325474
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4325474
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4325474
SSDB
Motif
Pfam: PAP2 Colicin_V DUF3094
Other DBs
NCBI-GeneID: 4325474
NCBI-ProteinID: XP_015632821
UniProt: Q0JQT7 A0A0P0UY14
LinkDB
Position
1:2097197..2101706
AA seq 313 aa
MRGENTDGRREVQLGPHTIQTHGVRLARNHLHDWVVLILLAAVVIALHFAPPFSRFVGKD
MMTYVSYPVKQSTVPAWGVPIISIVCPVIIFLSVYIARRDVYDLHHATLGVLYSVLITAV
VTTVVKNAVGRPRPDFFWRCFPDGKQLYDQVTGDVICHGEKSFLKDGRKSFPSGHTSWSF
AGLGFLSLYLSGKIKVFDRQGHVAKLCIMILPLLIASLVGISRIDDYRHHWEDVFAGGLL
GFIMAMLCYLHFFPPPYHHQGWGPYAYFHMLEELQVANSHNAESQQSVCGHHVELSRLHN
SRTSRNDLEAGRV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgcgtggagagaatacggatgggaggagggaggttcagctgggccctcacacgattcag
acacatggagttagattggccagaaatcacctgcatgattgggtcgttcttattttactt
gctgcagttgtgattgccctgcatttcgctcctccatttagccggtttgttgggaaggat
atgatgacttatgttagttacccggtgaaacaaagcactgtaccagcatggggtgttcct
ataatatccatagtttgccctgtaattatctttctatccgtttatatcgctaggagagat
gtctatgatcttcatcacgcaacattaggtgtgctttactcggtgctgataactgcagtt
gtaactactgtggtaaagaatgcagtaggaagacctaggccagacttcttttggcggtgt
tttcctgatggaaagcagttatatgatcaagtgacaggtgatgtgatttgtcatggagag
aaaagcttcttaaaggatggacgcaagagttttcctagtggacacacgtcgtggtctttt
gctggacttggatttctgtcactctacctatctggcaaaattaaggtgtttgatcgccaa
ggtcatgttgccaaactttgcattatgattcttccccttcttattgcttcactcgtcggg
atttctagaatagatgactatcgacaccactgggaggatgtgtttgctggcggcctacta
ggatttatcatggcgatgctctgttacttgcacttctttccacctccataccatcatcaa
ggttggggaccgtatgcatacttccatatgcttgaggagcttcaagtggccaactcccac
aatgcagaaagccagcagtcagtgtgtgggcatcatgttgagctatctagactacacaat
agcaggacatcaagaaatgatctggaagctggtcgtgtgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325649
Entry
4325649           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4325649
   00564 Glycerophospholipid metabolism
    4325649
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4325649
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4325649
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 4325649
NCBI-ProteinID: XP_015621444
UniProt: Q5N7Q9 A0A0P0V6W7
LinkDB
Position
1:28604998..28607655
AA seq 322 aa
MPAPSASIHLGVPTPYITSHGSKIARLHMYDWIVLILLVVVDGILNIIEPFHRFVGSDMM
TDLRYPMKDNTVPFWAVPIIGIIGPMIIITGIYFKKRNVYDFHHAILGLLFSVLITAVIT
DAIKDGVGRPRPDFFWRCFPDGVPAYDNFTTGVLCHGKASVIKEGHKSFPSGHTSWSFAG
LGFLSWYLAGKIKVFDRRGHVAKLCIIILPLLLAALVAVSRVDDYWHHWQDVFTGGILGL
VVSSFCYLQFFPMPSDENGLWPHAYARHILNPDQLENNAQPTSVDRPNSLPNGSFRSPNG
LEMGNTGQGQALDFMEAGRRYQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccggcaccatcggcatccatccatctgggagttccaactccgtacataacatctcat
ggatccaaaattgctcgcctacacatgtatgactggattgtgctgattcttctagtcgta
gtagatggaatactgaacataatagaaccattccatcgatttgttggatcggatatgatg
acagacctcagataccccatgaaagacaacacagtcccattttgggcggtcccgataatt
ggtatcattggaccaatgattatcatcactggaatatacttcaagaagaggaatgtgtat
gatttccatcatgccatactaggtctcctattttcagttcttatcacggcggtaataact
gatgccattaaagatggggttggtcgaccgcgtccagatttcttttggcgctgttttcct
gacggagtacctgcttatgataatttcactacaggagtgctttgtcatggtaaggcgagc
gttatcaaagaaggtcacaagagttttccgagtggccatacttcttggtcttttgctggc
cttggtttcctgtcatggtatctggctggtaaaataaaagtttttgacagaagaggccat
gttgcaaaactctgcattattattctccctctgctccttgcagccttggttgctgtttct
cgggtagatgactattggcatcattggcaagatgtgttcaccggtggaattttggggttg
gtggtttcttcattttgctacctccaattttttccaatgccatctgatgaaaacggatta
tggcctcacgcatacgcccggcacattctcaaccctgatcagctggagaacaacgcgcaa
cccacgtccgtggatcgccctaactctctgccgaacgggtcctttagaagccctaatgga
ttggaaatgggaaacacgggccaaggccaagcattagatttcatggaagctggtcgtaga
tatcaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326857
Entry
4326857           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4326857
   00564 Glycerophospholipid metabolism
    4326857
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4326857
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4326857
SSDB
Motif
Pfam: PAP2 CcmH
Other DBs
NCBI-GeneID: 4326857
NCBI-ProteinID: XP_015620074
UniProt: B9EYH6 Q0JKL6
LinkDB
Position
1:complement(27226198..27230310)
AA seq 295 aa
MPADARAAPPSCPFPTIRSHGAAVARSHAYDWLALLLLVAVDGLLNAIEPFHRFVGAGMM
TDLRYPMKRNTVPIWAVPIVAVIGPMIVFTVVYFRRRNVYDLHHAVLGILFSVLITGVLT
DAIKDAVGRPRPNFFWRCFPDGIAVFDNVTTGVICHGDASVIKEGHKSFPSGHTSWSFAG
LGFLSWYLAGKITVFDRRGHVAKLCVVLAPLLVAAMVAISRVDDYWHHWQDVCTGGVLGL
VVASVCYLQFFPAPSDEKGFWPHAHFRYITERGSENPTQQATEPLDAMETGRGGQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atgccggccgacgcgcgagctgctccgccgtcgtgcccgttcccgacgatacggtcgcat
ggcgccgccgtggcgaggtcgcacgcctacgactggctcgcgctgctcctcctcgtcgcc
gtcgacggcctcctcaacgccatcgagccgttccaccggttcgtcggcgccggcatgatg
accgatctcagataccccatgaagcgcaacaccgtccccatctgggccgtcccgatcgtc
gctgtcattgggcccatgattgtcttcaccgtcgtctacttcaggaggaggaacgtgtac
gatcttcaccatgctgtgctaggcattctgttttcggtgctgattaccggcgtgctcacc
gacgcgatcaaggatgccgtcggccgcccgaggccgaacttcttctggcgctgcttcccc
gacggaatcgcggtgttcgataacgtcaccacgggagtcatctgccacggcgacgcgagc
gtgatcaaggagggacacaagagcttcccgagcggccacacttcatggtctttcgccggt
ctggggttcctgtcgtggtaccttgccgggaagatcacggtgttcgaccggcgcgggcac
gtcgccaagctgtgcgtcgtcctcgcgcctctgctcgttgcggcgatggtcgccatctcg
agggtggacgactactggcaccattggcaagacgtctgcacgggaggcgtccttggattg
gtggttgcctctgtctgctatcttcagttcttcccggctccttcagatgagaaagggttc
tggcctcacgcgcactttaggtacatcaccgagaggggaagcgagaacccaacgcagcaa
gccaccgaaccactggacgccatggaaaccggtaggggaggccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339026
Entry
4339026           CDS       T01015                                 
Name
(RefSeq) phosphatidate phosphatase PAH1 isoform X1
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339026
   00564 Glycerophospholipid metabolism
    4339026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4339026
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4339026
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4339026
SSDB
Motif
Pfam: LNS2 Lipin_N Lipin_mid APP1_cat
Other DBs
NCBI-GeneID: 4339026
NCBI-ProteinID: XP_015639725
UniProt: B9FJI4
LinkDB
Position
5:complement(22706556..22713935)
AA seq 1074 aa
MNVVGRVGSLISQGVYSVATPFHPFGGAVDIIAVEQPDGSYRSTPWYVRFGKFQGVLKGA
EKVVTITVNGVDASFHMQLDNSGQAYFMRELVPGSENSGTSSEEEEASCEPEPPARSKSD
GDLYIGAKGRPGSPESNVECQEKQAIEEFDSYGYSRMEVAEDSAKQPDGSNSEMVLVSVD
GHVLTAPISSTEENVEDVQLSEPQFHLGPGESSSGDFSRSGEVWEAGIVGDLYMPQEKVK
FDSGNQQEALEELGDVPIETDKSHHVPVTGDEVLHTSVYEDVTSALTNEVESLVVPELGN
NDEDYQALINVDEVHDISENKNEGCRPPSSQYEVCDVSKTDDEGYQPLATEELGDVPIET
DRSHHVPVTGDEVLHTSVYEDVPSALTNEVESLVVLESGNNDEDYQALINVDEVHDISEN
KNEGCRPPSSQDEVCDVSKTDDEGYRPLATEDEARDVSKNNDEGYQPLATENEACDVPLL
ENDEACRVPANVDKVCDVSNEDTELEIASPSFGKYDTFKSCLDLSSQIDDGDSGTEPFSP
EFDHQQGFEFSLSNRSVVDIDLEEDISKTTHCDRNDPLQYLEEDNKTEGEDSSAHCRKVS
DMSIVGGSHGKTKETASSENEANRPDGLHSTIGTSDKDKLGSIPENSAAEEELNKEEHPK
LQKGLGFEISLCGHMLRPGMGQASAEEVFQQHLVLEEDFKLSGSSIMKNVNLVVKFDSQY
FLWSKISHIILGKAVFGPNFCTEHIDAIPVEHQETPTSRDSLGLSPSSRRWRLWNIPFRI
SRSLQRSNSDSSEDIFLDTETVLSPMDEQTPENNINQSPRKQFVRTLIPTSEQVASLNLK
EGQNIVTFSFSTRVLGKQQVEAHIYLWKWNAKIVISDVDGTITRSDVLGQVMPLVGRDWS
QSGVARLFSAIKENGYQLLFLSARAIVQAYLTKNFLFNLKQDGKVLPNGPVVISPDGLFP
SLYREVIRRAPHEFKIACLEDIKALFPSDYNPFYAGFGNRDTDELSYKKMGIPKGKIFII
NPKGEVAINSSVDVKSYTSLHTLVHDMFPPTTLVEQEDYNSWNYWKMPLPDVDL
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgaacgtggttgggcgggtagggtcgctgatctcgcagggggtgtactccgtcgcgacg
ccgttccacccgttcggcggcgcggtcgacatcatcgcggtcgagcagcctgacggctcg
tacaggagcacgccctggtacgtccggttcggcaagttccagggcgttctcaagggcgcg
gagaaggtggtcaccatcaccgtcaatggcgtggacgccagcttccacatgcagctcgac
aactctgggcaagcctacttcatgcgggagcttgtgcctggcagtgaaaattctgggaca
agttcggaggaagaggaagctagctgtgagcctgaacctccggcgcggagtaagagcgac
ggggatctttacatcggagcgaaaggcagaccaggtagcccggagtcgaatgtagagtgt
caagagaagcaagctatagaggagtttgattcatacggttatagcaggatggaggtagcg
gaagattcggcaaagcaacctgatgggagcaattcagagatggttttggttagtgtggat
gggcatgtcctcaccgcccccatttcctcgaccgaggagaatgtggaggatgtgcagcta
agtgaaccccaattccacttgggacctggggagagctcaagtggtgatttcagccgcagt
ggtgaggtgtgggaagctggcattgtcggtgatttatacatgccacaggaaaaggttaag
tttgattctggaaatcaacaagaggctttggaagaacttggtgatgtaccaattgagacg
gataagtcacatcatgtccctgttactggagatgaagtgctccatacctcagtttatgaa
gatgtgactagtgcattgaccaatgaagtcgaatctctagttgtcccagagttagggaat
aatgatgaggactatcaagccttgatcaatgtagatgaggtccatgacatctcagagaac
aaaaatgagggttgccgacccccttctagccaatatgaggtttgtgatgtctccaagacc
gatgatgagggatatcagcccttggccactgaagaacttggtgatgtaccaattgagacg
gataggtcacatcatgtccctgttactggagatgaagtgctccatacctcagtttatgaa
gatgtgcctagtgcactgaccaatgaagtcgagtctctagttgtcctagagtcagggaat
aatgatgaggactatcaagccttgatcaatgtagatgaggtccatgacatctcagagaac
aaaaatgagggttgccgacccccttctagccaagatgaggtttgtgatgtctccaagacc
gatgatgagggatatcggcccttggccactgaagatgaggctcgtgatgtctccaagaac
aatgatgaggggtatcagcctttggccactgaaaatgaggcttgtgatgttccactgctt
gagaatgacgaggcttgcagggtgccagctaatgtagacaaggtttgcgatgtcagcaat
gaggacactgagttagaaattgctagtcctagttttggtaaatatgatacttttaaaagt
tgcttagacctctcatcacaaatagatgacggagattcgggaactgaaccattttctcct
gaatttgatcatcagcagggttttgaatttagtctgagtaatcgttctgttgttgacata
gatctggaggaagatataagtaaaactacccactgtgatcgaaatgatccattacagtat
ctagaggaggataataaaacagaaggtgaagatagttctgcccactgtcgcaaggtatct
gatatgtccattgtaggaggttctcatggcaagaccaaggagacagcctcttctgaaaat
gaggcgaataggcctgatggtttacattcaaccattggaaccagtgacaaagacaaatta
ggtagcattccagagaactcagcagctgaagaggaactaaataaagaagagcatcccaaa
ttacaaaagggcttggggttcgaaatttctctttgtgggcacatgctacggccaggaatg
ggccaagcatcagctgaagaagttttccaacaacatcttgttcttgaggaagatttcaag
ttatcaggatcatcaattatgaaaaatgtaaaccttgttgtcaaatttgatagtcagtat
ttcttatggagtaaaatttctcatattattcttgggaaagctgtctttggtccgaacttc
tgcacagaacatattgatgctattccggttgaacaccaagaaacacctacttcaagagat
tctcttgggctgtctccctcaagcaggagatggaggctttggaacataccattcaggata
tcaagatcccttcagcgcagtaacagtgattcatccgaggacatttttcttgacacagaa
actgtcttgagtccaatggatgagcaaactccagagaataatataaatcagtcaccaaga
aagcaatttgtgcgaacattaattcccactagtgaacaggtggcatcactaaacctgaag
gagggccaaaacattgtaacttttagcttctccaccagagttcttggaaagcaacaggtt
gaggcacatatttacttgtggaaatggaatgctaaaattgtcatttctgatgtggatgga
accattacaaggtctgatgtgttgggccaggtcatgcctttagttggacgagattggagt
cagtctggtgttgctcgtcttttttctgcaataaaggaaaatggatatcaactattattc
ctcagtgctagagctatagttcaggcatacctgaccaaaaactttctattcaacctaaaa
caggatgggaaggtattgcctaatggacctgttgtgatttcacctgatggtttatttccg
tcattgtaccgggaagttatacgaagagcaccacatgagtttaagattgcatgtctggag
gacattaaagcacttttcccttctgattacaatccattttatgctggatttggcaacaga
gatacagatgagcttagttacaaaaagatgggaattccaaaagggaaaatctttatcatc
aacccaaagggggaagtagccataaacagttctgtcgacgtgaagtcctatacctcctta
catacccttgtccatgatatgttccctccaaccactcttgttgagcaggaagactacaat
tcctggaattactggaagatgccattgccagatgttgatctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339523
Entry
4339523           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339523
   00564 Glycerophospholipid metabolism
    4339523
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4339523
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4339523
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 4339523
NCBI-ProteinID: XP_015637620
LinkDB
Position
5:complement(27310792..27314859)
AA seq 316 aa
MPPPPPATSPAPAAIRLGAPHPYLRTHGTKVARLHLLDWIVLALLVAIDAGLNLIEPFHR
FVGEDMMISLRYPLKRNTVPIWAVPIYAVAGPMIIFIVIYMKRRNVYDLHHAILGLLFSV
LITAVLTDAIKDGVGRPRPNFFWRCFPDGIPKYNNITRGVICHGDKSVIKEGHKSFPSGH
TSWSFAGLGFLSWYLAGKIKAFDRGGHVAKLCIVVLPLLIAAMVGVSRVDDYWHHWQDVF
TGGILGLVVASFCYLQFFPPPAGEQGFWPHAYFEHILHPEVENQVQLTATSNHHQGLDMR
TNNQSLDSMEEGRRAR
NT seq 951 nt   +upstreamnt  +downstreamnt
atgccgccaccgccgccggcgacgtcgccggcgccggcagccattcggctgggagccccg
cacccgtacctgagaacccacgggaccaaggtcgcgaggctgcacctgctcgactggatc
gtgctggccctcctcgtcgccatcgacgccggcctcaacctgatcgagccgttccaccgg
ttcgtcggagaagacatgatgatcagcctccggtacccgctcaagcgcaacaccgtcccc
atctgggccgtccccatatatgctgtcgctgggccgatgatcatcttcattgtgatatac
atgaagaggaggaatgtgtatgacctgcatcatgcgatcctagggcttctgttttctgtg
ctgatcactgccgtcctgaccgacgcgatcaaggatggcgttggccggcctcgcccgaat
ttcttctggcgatgctttcctgacgggatcccgaagtacaacaacatcaccagaggtgtc
atctgccatggggataaaagtgtcatcaaagaagggcacaagagcttcccaagtggccat
acctcatggtcttttgccggattaggcttcctgtcatggtacctggccggcaagatcaag
gcgttcgacagaggagggcatgtggccaagctctgcattgtcgtcttgcctctgcttatt
gcagcgatggttggggtctcaagggtggatgactactggcaccattggcaggacgtgttt
accggtggaattcttggattggtggttgcttccttctgctaccttcagttcttcccacca
cctgctggtgaacaaggattttggcctcatgcatactttgagcacattcttcacccagaa
gttgagaaccaggtgcagctaacagctacttcaaatcatcatcaaggcctggacatgaga
accaacaaccagtcattagattccatggaagaaggccgaagagctcggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345366
Entry
4345366           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4345366
   00564 Glycerophospholipid metabolism
    4345366
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4345366
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4345366
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-GeneID: 4345366
NCBI-ProteinID: XP_015648580
UniProt: Q6YZK3 Q0J673
LinkDB
Position
8:complement(16513726..16517952)
AA seq 310 aa
MADTQLGCHTIGSHGIKVAKFHLYDWMILIFLAVVYGLFNIIEPFHRFVGSDMLTDLRYP
LKGNTVPFWAVPLIAIVLPWAIFGGIYFKKKNVYDLHHGILGILYSVLITAVITDAIKNG
VGRPRPDFFWRCFPDGKPNFNNVTGDVICHGERSVIKEGYKSFPSGHSSGAFAGLGFLAW
YLAGKLKAFKREGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFC
YLQFFPYPFDADAIWPHAHFQLLAESRSNGNENSHNMGWTETDAFHEGAGAVALRDTSLV
LDSMESGRRF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggctgatacccagttagggtgccatactataggatctcatggcattaaagtggcaaaa
ttccatttgtatgattggatgatacttatctttctagctgttgtttatgggctgttcaac
ataattgagccttttcaccgcttcgttggaagtgacatgctgacagacttgagatatcca
ctgaagggcaatacagttccattttgggctgttccactgattgcaattgtgctgccctgg
gccatctttggtggaatttacttcaaaaagaaaaatgtctatgatttgcaccatggcatt
ctggggattctatattcggtgcttataactgctgtgattactgatgcaattaagaatggt
gttggtcgcccacgcccagatttcttttggcgttgtttccctgatggaaagcctaatttc
aataatgtcactggtgatgtcatatgccatggagaaaggagtgtcatcaaggaaggctac
aagagcttcccaagtgggcattcttcaggggcttttgctggtctgggttttcttgcgtgg
tacttagcaggcaaacttaaagcttttaaacgtgaagggcatattgcaaaactatgccta
gtctttctgcctctacttgttgcatcacttgtggcagtctctcgggttgacgattactgg
catcactggcaagatgtatttgcaggcggcattataggtctcacagttgcttcgttttgt
tacctgcaatttttcccatatccatttgatgctgatgctatatggcctcatgctcacttc
caactgctagccgagtcacgaagcaacggtaatgaaaactcacacaacatgggatggaca
gagaccgacgctttccatgaaggcgctggtgctgttgcgctgagagacacaagcctggtt
ctagactcgatggagtctggcaggaggttttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345367
Entry
4345367           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4345367
   00564 Glycerophospholipid metabolism
    4345367
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4345367
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4345367
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 4345367
NCBI-ProteinID: XP_015650942
UniProt: Q0J672 Q6YZK2
LinkDB
Position
8:complement(16519519..16523975)
AA seq 310 aa
MPDIQLGCHTIRSHGTSVARLHMYDWIILLFLAVVDGLLNIIEPFHRFVGRDMMTDLRYP
LKGNTIPFWAVPLIAIVLPWVVFGGIYFKKKNVYDLHHGILGILYSVLITAVITDAIKDG
VGRPRPDFFWRCFPDGIPKFDNVTTNVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAW
YLAGKLKAFDRKGHIAKLCIVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVSSFC
YLQFFPYPFDADAVWPHAYFQQLADTQSNGIANSYNMGPTDIEIADEGHGAISLRDTSPI
LDTMESGRRG
NT seq 933 nt   +upstreamnt  +downstreamnt
atgcctgatatccagttagggtgccacactataaggtcccatggaaccagtgtggcaaga
ctccacatgtatgactggataatacttctctttcttgctgttgttgatgggctgctaaac
ataattgagccttttcaccgctttgttggacgtgacatgatgacagacttgagatatcca
ctaaagggcaacacaattccattttgggccgttccacttattgcaattgtgctgccctgg
gttgtctttggtggaatttacttcaaaaagaaaaatgtctatgatttacaccatggcata
ctggggattctatattcggtacttataactgctgtgattactgatgcaattaaggatggt
gttggtcgtcctcgcccagatttcttttggcgttgtttccctgatggaatacctaagttt
gataatgtcactacaaatgtcatatgccatggagaaaagagtgttatcaaggaaggccac
aagagctttccaagtgggcattcttcatggtcttttgctggtctaggttttcttgcgtgg
tacttggctggtaaacttaaggcttttgatcgcaaaggccacattgcaaagttatgcata
gtatttctgcctctacttgttgcgtcccttgtggcagtctctcgagttgatgattactgg
catcactggcaagacgtatttgcaggtggcattataggtcttacggtttcttcgttttgt
tatctgcagttcttcccatatccatttgatgctgatgctgtatggccccatgcatacttc
caacagctagctgacacacaaagcaacggcattgcaaactcatacaacatgggaccaaca
gacattgagattgctgacgaaggccatggtgccatttccctgagagacaccagtcctatt
ttagacacgatggagtctggtaggagaggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346680
Entry
4346680           CDS       T01015                                 
Name
(RefSeq) lipid phosphate phosphatase 2
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4346680
   00564 Glycerophospholipid metabolism
    4346680
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4346680
    3.1.3.81  diacylglycerol diphosphate phosphatase
     4346680
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-GeneID: 4346680
NCBI-ProteinID: XP_015612563
UniProt: Q69N94
LinkDB
Position
9:complement(8151827..8158606)
AA seq 307 aa
MADVLGCYTIKSHGTKVARLHMYDWIILLLLAVIDGLLNIIEPFHRFVGRDMMTDLRYPL
KGNTVPFWAVPLIGIVLPCAIFGGIYFKKKNFYDLHHGILGILYSVLITAVITDAIKDGV
GRPRPDFFWRCFPDGKDVYDNVTTGVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWY
LAGKITVFDRRGHVAKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGSLIGLTVASFCY
LQFFPYPYDADAFWPHAYTFQLAEASRNNNTANSYSVRPTGFETVNVPEGHGGIALRDTN
LEAGRRP
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcagatgtcttaggatgttacactataaagtcccatggaaccaaagtggcgagactt
cacatgtacgactggataatacttctactccttgctgttatagatggactgttgaacata
attgaaccttttcaccgtttcgtcgggagggacatgatgactgacttgagatatccattg
aagggcaatactgttcccttctgggctgttccgctcattggaattgtattgccttgtgcc
atctttggtggaatttacttcaaaaagaagaatttctatgatttgcaccatggcatactg
gggatcctatactctgtgcttataactgcggtaatcacagatgcaattaaggatggtgtg
ggtcgtccacgcccagattttttctggcgctgtttcccagatggaaaggatgtttatgat
aatgtcactactggtgtcatatgccatggagagaagagtgtcatcaaagaaggtcacaag
agctttccaagcgggcactcttcatggtcttttgctggtctaggcttccttgcatggtac
ttagctgggaagatcacagtttttgatcgtagaggtcatgttgcaaagctatgcatagta
tttctgcctcttcttactgctgcacttgtggctgtttctcgagtggatgactactggcat
cactggcaggatgtatttgcaggctctctgataggtcttacagtcgcatcattttgttat
ctgcaattcttcccatatccttatgacgcagacgctttctggcctcatgcatacaccttc
cagctagcggaggcctcgcgcaacaataacaccgcaaactcctacagcgtgagaccgacc
gggttcgagactgtcaatgtcccagaagggcatggtgggattgctctgagagacaccaac
ctagaggccggcaggagaccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350917
Entry
4350917           CDS       T01015                                 
Name
(RefSeq) phosphatidate phosphatase PAH2 isoform X1
  KO
K15728  phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4350917
   00564 Glycerophospholipid metabolism
    4350917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4350917
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     4350917
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4350917
SSDB
Motif
Pfam: LNS2 Lipin_N Lipin_mid
Other DBs
NCBI-GeneID: 4350917
NCBI-ProteinID: XP_015617116
UniProt: A0A8J8XDC4 Q2R178
LinkDB
Position
11:23902245..23909197
AA seq 1387 aa
MYAVGKFGSFISRSVYTVSGPFHPFGGAVDVVVVQQQDGGGFKSSPWYVRFGKFQGVLKT
REKVVTIAVNGVEAGFHMYLDSNGEAYFLRNGEPNLEEGEFAVSPVSSGDERDEAAPPPP
LPVQDTQLRKSKSISCDSSTMEANAGDGKILARTSSRRVTILERMFGRKSIKDGPDGVDR
VSSLERAEIAAELLDTNWSTNPPRGAKARRSLDEPSKSNLEDPVNGNQVETSKVVSPSCS
IDQEKDMGSSNRGSVDSNFFSPQGGTDSLGDENNHYIQTTSVKEEVVEIYTRDSSVSIDG
TDQAGIESSSNDPGTDKITSEPIDTQSEKIISEPIETQSEKIISEPIDTQSEKIISEPIE
TQSEKIISEPIDAQSEKIISEPIEAQSEKIISEPIDTQTEKIISDPIEAQSEKIISEPID
AQTEKIISEPIEAQSEKIISEPIDTQTEKIISDPIDTQSEKIISEPIDTQTEEIISDPID
TQSEMLDNFQDDTGREMHTREVLSHVIFETHAGETNITIGKSEEISQFVTVKTCQDCSDA
NSPVYETAGLSSEMHDISSITSAQDACQEKVVIVSSYETVETSYNVPDILVDKVCHAVGN
PLDDSLQPKEQSGVSIEEIEHVSFEDKPLSYYGASSNIEDMTKLGIQDQQVPVFEDSGSQ
NSQEFVPDKDICVDTVVNDRSAHIVNDLACNHDFVFPAASSSVEEISNYVPDNHLHDVTK
DFIVENKTCNGELNISLVQTSTTGDETTECISPSANIPNKVELQGSQIISDLSSLRKVEA
ESTTLEDTESRSSSASGVEIKLVPEAIYEPREEAEAVVSFSEFVEEIQFQFSDSESFADR
KTTDDAASTKEAGAVEHDESDCDTEQQGGNNTGLGNNLENCSDSSRPETIPVPIPGSEFH
SDDNNLEAKSLPNLRSHIHDLERSDSFQLSRSLQSNGENNGVEPVKSTTSDLPIQEPEDT
GDSKENFVPPEPTNSAIADNLKIDPFNPCVELSLCRHLLSEGMGEDAACKAFDAEKVTLE
KFRAMKQSLIRNNKLVVRIAGRYFPWDAAAPVILGMVSFQEEQSFEPQGMIKVERVEPNA
APGGWRIWPFSFKRTRSVNTVQPVSESTEEASSSAPVKEVERENNKPRAKRMERKVRSLT
PTSEELASLDLREGRNVVTFTFSTGMLGKQQVDAHIYLWKWNARIVISDVDGTITKSDVL
GQFMPLVGVDWSQNGVAHLFSAIKENGYQLLFLSARAISQAHLTRQFLFNLKQDGKALPD
GPVVISPDGLFPSLYREVIRRAPHEFKISCLGAIKALFPPDSNPFYAGFGNRDTDELSYL
KVGIPMGKIFIINPKGEVAVNRRVDTKSYTSLHALVNGMFPPISTSSEQEDYNTWNYWKM
PLPAVDI
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgtacgcggtggggaagttcgggagcttcatctcgcggagcgtgtacaccgtctccggc
ccgttccacccgttcggcggcgcggtggatgtagtggtggtgcagcagcaggacggcggc
gggttcaagagctcgccgtggtacgtccggttcggcaagttccagggggtgctcaagacg
cgggagaaggtggtcaccatcgccgtcaatggcgtcgaggccgggttccacatgtacctc
gacagcaacggggaggcctacttcctccgcaacggggagcccaacctcgaggaaggggag
ttcgccgtgtcccccgtgtcgtccggggacgagcgggacgaggcggcgccgccgccaccg
ctgccggtgcaggacacgcagctcaggaagtcgaagagcatatcgtgcgatagctccacc
atggaggccaatgccggggacggcaagatcctcgcgaggacgagctcgaggcgggttacc
atactcgagcggatgtttggtcggaaatcgatcaaggacggtccggatggggtggatagg
gtgagctcgttagagcgtgccgagattgctgctgagctccttgataccaattggtcgacg
aatccgccacgtggtgcaaaagctcgtagatctctcgatgagccttccaagagtaattta
gaagatcctgtaaatggtaatcaggtggaaacctcaaaagtggtatcgccgtcatgtagc
attgatcaggagaaagacatgggctcctctaatagaggcagtgtggatagcaattttttt
agtccgcagggaggaacagatagtttgggagatgaaaacaaccattatatacaaacaact
agtgtcaaggaggaagttgttgagatttacacgcgtgatagcagtgtttcgattgatggt
acagaccaggcaggaatagagtcttcatcaaatgatccaggtacagataaaattaccagt
gagcccattgatactcaaagtgagaaaattatcagtgagcccattgaaacgcaaagtgag
aaaattatcagtgagcccattgatactcaaagtgagaaaattatcagtgagcccattgaa
acgcaaagtgagaaaattatcagtgagcccattgatgctcaaagtgagaaaattatcagt
gagcccattgaagcgcaaagtgagaaaattatcagtgagcccattgatactcaaaccgag
aaaattatcagtgaccccattgaagcgcaaagtgagaaaattatcagtgagcccattgat
gctcaaaccgagaaaattatcagtgagcccattgaagcgcaaagtgagaaaattatcagt
gagcccattgatactcaaaccgagaaaattatcagtgaccccattgatactcaaagtgag
aaaattatcagtgagcccattgatactcaaaccgaggaaattatcagtgaccccattgat
actcaaagtgagatgttggataattttcaagatgacactggaagggaaatgcacaccagg
gaggtcctttcccatgttatttttgaaacccatgctggtgagacaaacattaccattggt
aagagtgaggagatttcacagtttgtcactgtaaaaacatgccaagattgttctgatgca
aattcacctgtttatgaaactgcaggtttgtcaagtgaaatgcatgacatctcttcaatt
acttctgctcaagatgcatgccaagagaaagtggtcattgtcagcagctatgagactgtg
gagacctcatataatgtgcctgatattttggttgacaaagtttgtcatgctgttggtaac
ccactggatgattctttacagcccaaagagcagtcgggagtctccattgaggaaatagaa
catgtaagttttgaggacaaaccactgtcatattatggtgcttccagcaatattgaagac
atgactaagctgggtattcaagaccaacaggtgccagtctttgaggattccggttcccaa
aactcccaagaatttgttccagacaaggatatttgtgtggatactgttgttaatgatcgt
agtgcccatatagtaaatgatttagcttgcaatcatgattttgtttttcctgctgcttct
tccagtgttgaagagatatcaaattatgtgcctgataatcatcttcatgatgtaacaaag
gacttcattgtggaaaataaaacatgcaatggagagcttaacatttcccttgtccaaacg
tcaacaacgggagatgagaccacagaatgcatttctccatcagctaatattcctaataaa
gtagaactgcaaggttcacagattatttctgatctttctagtttgagaaaggttgaagca
gaaagcaccacactagaagatactgaaagcagatctagttctgctagtggagtcgaaatt
aagcttgtgcctgaggctatatacgagccaagggaagaagcagaagcagttgtttcattc
tcagagttcgtagaagaaattcaatttcagtttagtgacagtgaaagctttgctgatcga
aagaccacagatgatgctgcatctactaaagaggcaggtgcagtagaacatgatgaatct
gattgtgacacagaacaacagggagggaataatacaggtcttggaaataacctggaaaac
tgttctgattcatcaaggcctgagactatccctgttcctattccaggaagtgagtttcac
tcagatgacaataatctggaggctaaatctctaccaaatctccgctctcacatacatgat
cttgaaaggtctgacagttttcagctaagccgctcactacagtcgaacggtgaaaataat
ggggttgagccagtcaagagtacaacttctgacttgccaattcaggaaccagaagatact
ggtgattcaaaagaaaattttgtcccaccggagcctactaacagcgcaatagctgataac
ctgaaaatagatccattcaatccttgtgtggaattatccctatgcaggcacctgttatca
gaaggcatgggagaagatgctgcatgcaaagcattcgatgcagagaaggtaaccttagag
aagtttcgtgccatgaagcagtcgctgataagaaacaacaagcttgttgttaggattgct
ggtcgatactttccgtgggatgcagctgcacctgtcatactgggcatggtttcttttcag
gaggaacaatcctttgaaccccaaggtatgataaaggtagagcgagttgagccaaatgca
gcaccaggtggctggagaatatggccattttctttcaaaaggacaaggtctgttaacact
gtccagccagtttctgaaagcactgaggaggcttcctcttccgctcctgttaaagaagtg
gagagagaaaacaacaaacccagggcaaagaggatggagagaaaagtgcgttcgctcact
ccaacatctgaggagctagcatctcttgatctcagagagggcaggaacgtggtaacattt
accttctcaactggaatgcttggaaaacagcaggtagatgctcacatatatttatggaaa
tggaatgcacgcattgtcatttcagatgttgatggaactatcaccaagtctgatgttctt
ggccagttcatgccgctggttggtgttgattggtctcaaaatggtgttgcacatttattt
tctgcaataaaggaaaatggatatcagttgcttttcttgagtgcgcgtgctatttcacaa
gctcacctgacaaggcagtttcttttcaaccttaagcaggatggaaaagctcttcctgat
ggccctgttgtgatatctcctgatgggctatttccatcactttacagagaagttatcaga
cgagctcctcacgaattcaagatctcatgcctaggggctatcaaagcactatttcctcct
gactcaaatccattctatgctggatttggaaatagagatacagatgagcttagttacctc
aaggttgggattcctatgggcaaaatttttattataaatcccaagggtgaagttgcggtg
aatcgtcgagtagatacaaaatcatacacatccctccatgctcttgtcaatgggatgttc
cctccgatatcaacgtcatctgagcaggaggactacaatacttggaattactggaaaatg
ccgttacctgctgttgatatttga

DBGET integrated database retrieval system