KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325478
Entry
4325478           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L26-1
  KO
K02898  large subunit ribosomal protein L26e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325478
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4325478
SSDB
Motif
Pfam: Ribosomal_L26 KOW Musclin DUF525
Other DBs
NCBI-GeneID: 4325478
NCBI-ProteinID: XP_015621469
UniProt: Q9AWS9
LinkDB
Position
1:2137757..2138565
AA seq 157 aa
MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSSELRHKYNVRSIPIRKDDEVQVVRG
SYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDR
KARGRAADKAKGKFTADDVAAAAGGAAATGASLQEID
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaagcgcaacccacgcgtgacgagctcccggaggaagtgccgcaaggcgcacttcacg
gcgccgtcgtccgtccgccgcgtgctcatgtcggcggcgctgtcgtcggagctccgccac
aagtacaacgtgcggtccatcccgatccgcaaggacgacgaggtgcaggtggtgaggggg
agctacaaggggcgcgaggggaaggtggtgcaggtgtaccgccgtcgctgggtcatccac
gtcgagcggatcaccagggagaaggtgaacggctccaccgtcaacgtcggcatccacccc
tccaaggtcgtcgtcaccaagctcaagctcgacaaggaccgcaaggccatcctcgaccgc
aaggcgcgcggccgcgccgccgacaaggccaagggcaagttcaccgccgacgacgtcgcc
gccgccgccgggggtgccgccgccaccggcgcctcgctccaggagatcgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349791
Entry
4349791           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L26-1
  KO
K02898  large subunit ribosomal protein L26e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349791
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4349791
SSDB
Motif
Pfam: Ribosomal_L26 KOW Musclin DUF525
Other DBs
NCBI-GeneID: 4349791
NCBI-ProteinID: XP_015617829
UniProt: A3C8P4 Q53Q51
LinkDB
Position
11:complement(2382477..2383260)
AA seq 153 aa
MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPVRKDDEVQVVRG
SYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDR
KASGRAADKAKGKFTAEDVAAAGAAGASLQEID
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaagcgcaatccgcgcgtgacgagctcccggcgcaagtgccggaaggcgcacttcacg
gcgccgtcgtccgtccgccgcgtcctcatgtccgccgcgctctccaccgagctccgccac
aagtacaacgtccgctccatccccgtccgcaaggacgacgaggtgcaggtggtgaggggg
agctacaagggccgcgagggcaaggtggtgcaggtctaccgccgccggtgggtgatccat
gtcgagcgcatcaccagggagaaggtgaacgggtccaccgtcaacgtcgggatccaccca
tccaaggtcgtcgtcaccaaactcaagctcgacaaggaccgcaaggccatcctcgaccgc
aaggccagcggtcgcgccgccgacaaggccaagggcaagttcaccgccgaggacgttgcc
gccgccggcgccgccggggcctcgctccaggagatcgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351513
Entry
4351513           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L26-1
  KO
K02898  large subunit ribosomal protein L26e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4351513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4351513
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4351513
SSDB
Motif
Pfam: Ribosomal_L26 KOW Musclin DUF525
Other DBs
NCBI-GeneID: 4351513
NCBI-ProteinID: XP_015618223
UniProt: Q2QXN5 A3CEZ4
LinkDB
Position
12:complement(2460553..2461329)
AA seq 150 aa
MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPIRKDDEVQVVRG
SYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDR
KASGRAADKAKGKFTAEDVAAAGASLQEID
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaagcgcaacccacgcgtgacgagctcccggcggaagtgccggaaggcgcacttcacg
gcgccgtcctccgtccgccgcgtcctcatgtccgccgccctctccaccgagctccgccac
aagtacaacgtccgctccatccccatccgcaaggacgacgaggtgcaggtggtgaggggg
agctacaagggccgcgaggggaaggtggtgcaggtctaccgccgccggtgggtgatccac
gtcgagcgcatcacgagggagaaggtgaacgggtccaccgtcaacgtcgggatccacccc
tccaaggtggtcgtcaccaagctcaagctcgacaaggaccgcaaggccatcctcgaccgc
aaggcgagcggccgcgccgccgacaaggccaagggcaagttcaccgccgaggacgtggcc
gccgccggcgcctcgctccaggagatcgattag

DBGET integrated database retrieval system